Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F8PYP5

Protein Details
Accession F8PYP5    Localization Confidence High Confidence Score 16.3
NoLS Segment(s)
PositionSequenceProtein Nature
20-42NGLYLERKRKEKKGSENGKKSYSHydrophilic
87-107HRSFECKDAQKRKPQFNVREFHydrophilic
NLS Segment(s)
PositionSequence
26-52RKRKEKKGSENGKKSYSEQKKEGEKKR
Subcellular Location(s) nucl 17, mito 7, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR001878  Znf_CCHC  
IPR036875  Znf_CCHC_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003676  F:nucleic acid binding  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF13917  zf-CCHC_3  
PROSITE View protein in PROSITE  
PS50158  ZF_CCHC  
Amino Acid Sequences MNKPLVDRRLPRVEKRTHQNGLYLERKRKEKKGSENGKKSYSEQKKEGEKKRDGTGYTYTGNGERMEVDKAKFHTEGRCYRCGEKGHRSFECKDAQKRKPQFNVREFLEKMTKEEREKLLEGF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.72
2 0.77
3 0.78
4 0.73
5 0.68
6 0.64
7 0.59
8 0.58
9 0.58
10 0.56
11 0.55
12 0.55
13 0.63
14 0.64
15 0.68
16 0.7
17 0.71
18 0.74
19 0.77
20 0.82
21 0.84
22 0.87
23 0.83
24 0.77
25 0.69
26 0.62
27 0.62
28 0.6
29 0.55
30 0.5
31 0.52
32 0.57
33 0.65
34 0.71
35 0.69
36 0.65
37 0.62
38 0.62
39 0.6
40 0.5
41 0.44
42 0.39
43 0.33
44 0.28
45 0.25
46 0.21
47 0.17
48 0.17
49 0.14
50 0.1
51 0.08
52 0.08
53 0.1
54 0.11
55 0.11
56 0.13
57 0.14
58 0.17
59 0.18
60 0.18
61 0.21
62 0.26
63 0.34
64 0.36
65 0.4
66 0.4
67 0.41
68 0.45
69 0.46
70 0.47
71 0.49
72 0.52
73 0.54
74 0.56
75 0.59
76 0.56
77 0.55
78 0.57
79 0.54
80 0.56
81 0.59
82 0.62
83 0.68
84 0.74
85 0.78
86 0.79
87 0.81
88 0.82
89 0.79
90 0.8
91 0.73
92 0.73
93 0.65
94 0.6
95 0.57
96 0.48
97 0.45
98 0.44
99 0.46
100 0.42
101 0.48
102 0.48
103 0.46