Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q0U111

Protein Details
Accession Q0U111    Localization Confidence Low Confidence Score 7.2
NoLS Segment(s)
PositionSequenceProtein Nature
2-26LKSLPSSQLRHRRPRTTPRVFLPRGHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 13, nucl 7.5, cyto_nucl 7.5, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR003213  Cyt_c_oxidase_su6B  
IPR036549  Cyt_c_oxidase_su6B_sf  
Gene Ontology GO:0005758  C:mitochondrial intermembrane space  
GO:0045277  C:respiratory chain complex IV  
GO:0033617  P:mitochondrial cytochrome c oxidase assembly  
KEGG pno:SNOG_14520  -  
Pfam View protein in Pfam  
PF02297  COX6B  
PROSITE View protein in PROSITE  
PS51808  CHCH  
Amino Acid Sequences MLKSLPSSQLRHRRPRTTPRVFLPRGHCTQFASPDFLPRTLTQHTANMGWFSSSPKDEGGPAKTSGGAFEQPNRSNRKQCYAARDAFFECLDKNNVLDSINTKSGREKAQTFCGQLDQEFEKNCAHSWVEYFKKQRVVNYQREQTIKRIESQGGEIVAPQLPLPGQK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.86
3 0.87
4 0.86
5 0.84
6 0.82
7 0.84
8 0.78
9 0.75
10 0.72
11 0.69
12 0.65
13 0.61
14 0.53
15 0.46
16 0.48
17 0.48
18 0.42
19 0.39
20 0.34
21 0.37
22 0.38
23 0.35
24 0.33
25 0.27
26 0.29
27 0.26
28 0.29
29 0.24
30 0.24
31 0.25
32 0.24
33 0.23
34 0.2
35 0.17
36 0.14
37 0.13
38 0.12
39 0.13
40 0.13
41 0.13
42 0.13
43 0.13
44 0.15
45 0.18
46 0.19
47 0.19
48 0.19
49 0.19
50 0.19
51 0.18
52 0.16
53 0.15
54 0.14
55 0.12
56 0.16
57 0.21
58 0.24
59 0.29
60 0.36
61 0.37
62 0.42
63 0.43
64 0.45
65 0.47
66 0.47
67 0.49
68 0.48
69 0.49
70 0.43
71 0.43
72 0.37
73 0.31
74 0.28
75 0.21
76 0.15
77 0.12
78 0.13
79 0.11
80 0.1
81 0.1
82 0.1
83 0.1
84 0.1
85 0.1
86 0.12
87 0.18
88 0.18
89 0.18
90 0.2
91 0.23
92 0.26
93 0.28
94 0.28
95 0.27
96 0.34
97 0.38
98 0.37
99 0.34
100 0.33
101 0.3
102 0.25
103 0.26
104 0.21
105 0.2
106 0.19
107 0.2
108 0.19
109 0.19
110 0.19
111 0.18
112 0.16
113 0.14
114 0.16
115 0.22
116 0.26
117 0.33
118 0.37
119 0.39
120 0.46
121 0.46
122 0.5
123 0.53
124 0.56
125 0.6
126 0.65
127 0.67
128 0.65
129 0.69
130 0.65
131 0.61
132 0.62
133 0.53
134 0.49
135 0.46
136 0.42
137 0.39
138 0.4
139 0.37
140 0.28
141 0.26
142 0.21
143 0.19
144 0.18
145 0.16
146 0.12
147 0.1