Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

F8PTG9

Protein Details
Accession F8PTG9    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
51-70PVFFIPKKDGKKRCHAPKLIHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 23.5, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR043502  DNA/RNA_pol_sf  
IPR032567  LDOC1-rel  
Amino Acid Sequences DHAIDLKDTFKPRKGHMIPLSAPERDEVSSFIDKQLRKGYIRPSKSPMTSPVFFIPKKDGKKRCHAPKLIGSMDRCQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.55
3 0.55
4 0.57
5 0.52
6 0.54
7 0.54
8 0.43
9 0.41
10 0.31
11 0.27
12 0.2
13 0.19
14 0.13
15 0.14
16 0.16
17 0.16
18 0.18
19 0.21
20 0.21
21 0.23
22 0.28
23 0.26
24 0.25
25 0.28
26 0.36
27 0.4
28 0.44
29 0.45
30 0.44
31 0.46
32 0.46
33 0.45
34 0.42
35 0.39
36 0.36
37 0.35
38 0.35
39 0.35
40 0.34
41 0.34
42 0.35
43 0.36
44 0.44
45 0.51
46 0.55
47 0.56
48 0.67
49 0.76
50 0.79
51 0.82
52 0.8
53 0.78
54 0.77
55 0.79
56 0.74
57 0.7