Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F8Q843

Protein Details
Accession F8Q843   
Localization Confidence Medium
Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
15-44PSICSSRSCPWPPRHKRKYNRRAYGPESASHydrophilic
NLS Segment(s)
PositionSequence
131-138RRKIRQRR
Subcellular Location(s) nucl 12.5, mito 10, cyto_nucl 8.5, cyto 3.5
Family & Domain DBs
Amino Acid Sequences MALRRYTATSRVRYPSICSSRSCPWPPRHKRKYNRRAYGPESASSALYLFQAPIFAHGSTTWPYPVTPYADKHTHLSIYPQASKIKRGWAGLVSSTIKRARSHAPISCLDSRSKLPTVSNMFFFTPPCPPRRKIRQRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.53
3 0.52
4 0.49
5 0.45
6 0.46
7 0.49
8 0.56
9 0.57
10 0.55
11 0.57
12 0.66
13 0.74
14 0.8
15 0.84
16 0.86
17 0.9
18 0.93
19 0.94
20 0.93
21 0.92
22 0.9
23 0.87
24 0.82
25 0.81
26 0.72
27 0.62
28 0.54
29 0.45
30 0.35
31 0.27
32 0.22
33 0.12
34 0.1
35 0.09
36 0.06
37 0.05
38 0.06
39 0.06
40 0.08
41 0.09
42 0.09
43 0.09
44 0.09
45 0.11
46 0.11
47 0.12
48 0.1
49 0.09
50 0.09
51 0.1
52 0.12
53 0.14
54 0.15
55 0.16
56 0.2
57 0.22
58 0.23
59 0.24
60 0.23
61 0.2
62 0.18
63 0.18
64 0.18
65 0.2
66 0.2
67 0.21
68 0.25
69 0.25
70 0.29
71 0.28
72 0.3
73 0.29
74 0.28
75 0.28
76 0.25
77 0.25
78 0.23
79 0.25
80 0.21
81 0.18
82 0.22
83 0.22
84 0.23
85 0.22
86 0.24
87 0.27
88 0.32
89 0.38
90 0.38
91 0.41
92 0.41
93 0.46
94 0.48
95 0.44
96 0.38
97 0.35
98 0.33
99 0.33
100 0.33
101 0.29
102 0.25
103 0.32
104 0.38
105 0.38
106 0.37
107 0.35
108 0.34
109 0.33
110 0.33
111 0.27
112 0.29
113 0.31
114 0.35
115 0.39
116 0.41
117 0.51
118 0.61