Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F8PGX8

Protein Details
Accession F8PGX8   
Localization Confidence Medium
Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
2-46AIKIPIIKKRTKCFKRHQSDRYHSVKDAWRKPKGIDNRVRRRFKGBasic
NLS Segment(s)
PositionSequence
30-44WRKPKGIDNRVRRRF
Subcellular Location(s) mito 14.5, mito_nucl 12.5, nucl 9.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MAIKIPIIKKRTKCFKRHQSDRYHSVKDAWRKPKGIDNRVRRRFKGQLPMPSIGYGSNKRTRHLLPNGYKRFLICNWKEIDILMMHNKRFAAEIAHNVSSRNRVLILERAKVLGVKVVNVTARLQVEEI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.86
3 0.88
4 0.91
5 0.9
6 0.89
7 0.89
8 0.88
9 0.84
10 0.78
11 0.67
12 0.63
13 0.62
14 0.6
15 0.61
16 0.61
17 0.59
18 0.57
19 0.58
20 0.61
21 0.63
22 0.64
23 0.64
24 0.66
25 0.71
26 0.78
27 0.83
28 0.76
29 0.73
30 0.71
31 0.68
32 0.67
33 0.63
34 0.61
35 0.6
36 0.6
37 0.53
38 0.45
39 0.39
40 0.29
41 0.26
42 0.21
43 0.21
44 0.27
45 0.27
46 0.27
47 0.3
48 0.32
49 0.36
50 0.4
51 0.44
52 0.44
53 0.54
54 0.57
55 0.55
56 0.53
57 0.45
58 0.41
59 0.35
60 0.37
61 0.27
62 0.29
63 0.29
64 0.3
65 0.3
66 0.26
67 0.25
68 0.16
69 0.17
70 0.19
71 0.21
72 0.19
73 0.21
74 0.21
75 0.2
76 0.2
77 0.18
78 0.15
79 0.14
80 0.2
81 0.23
82 0.26
83 0.26
84 0.26
85 0.27
86 0.26
87 0.24
88 0.2
89 0.16
90 0.15
91 0.17
92 0.25
93 0.28
94 0.28
95 0.28
96 0.28
97 0.27
98 0.27
99 0.24
100 0.21
101 0.16
102 0.14
103 0.15
104 0.17
105 0.18
106 0.19
107 0.2
108 0.19
109 0.2