Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F8PF79

Protein Details
Accession F8PF79   
Localization Confidence Medium
Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
198-219IEEKEKLKPKPKPKDASANVYSHydrophilic
NLS Segment(s)
PositionSequence
202-210EKLKPKPKP
Subcellular Location(s) mito_nucl 10.166, nucl 10, mito 10, cyto_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR005061  Ist1  
IPR042277  IST1-like  
Gene Ontology GO:0015031  P:protein transport  
Pfam View protein in Pfam  
PF03398  Ist1  
Amino Acid Sequences LSVQRLRIIEQKKEAQAKSSRRDIAMLLEKGKIESARVKVEAIIHEDIHVELLELLELYCELLLARFGLLDQNSREPDPGISEGVCSIIHAAPRTDLKELQVLRELLMHKYGREFSAAVMENRNGCVSDRVLKKLTIATPSGELVDGYLGEIARGYHVDWAPAPPPLRAVDDADADAVPRLPNLPPTEDEGEDEKGAIEEKEKLKPKPKPKDASANVYSSAYSPPPPMVQEPEDEDDFSALARRFEALKRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.6
3 0.63
4 0.64
5 0.64
6 0.65
7 0.61
8 0.54
9 0.55
10 0.48
11 0.47
12 0.47
13 0.43
14 0.36
15 0.34
16 0.33
17 0.32
18 0.33
19 0.25
20 0.19
21 0.22
22 0.24
23 0.27
24 0.28
25 0.28
26 0.27
27 0.3
28 0.3
29 0.28
30 0.26
31 0.21
32 0.2
33 0.2
34 0.19
35 0.16
36 0.13
37 0.08
38 0.06
39 0.06
40 0.05
41 0.05
42 0.05
43 0.04
44 0.04
45 0.04
46 0.03
47 0.03
48 0.03
49 0.03
50 0.04
51 0.04
52 0.04
53 0.04
54 0.04
55 0.07
56 0.08
57 0.11
58 0.13
59 0.17
60 0.19
61 0.2
62 0.2
63 0.18
64 0.18
65 0.18
66 0.18
67 0.14
68 0.12
69 0.12
70 0.11
71 0.11
72 0.11
73 0.07
74 0.08
75 0.08
76 0.09
77 0.1
78 0.1
79 0.11
80 0.13
81 0.15
82 0.15
83 0.15
84 0.15
85 0.2
86 0.2
87 0.19
88 0.21
89 0.2
90 0.18
91 0.21
92 0.21
93 0.16
94 0.2
95 0.19
96 0.15
97 0.16
98 0.17
99 0.14
100 0.14
101 0.14
102 0.09
103 0.15
104 0.16
105 0.15
106 0.15
107 0.16
108 0.15
109 0.15
110 0.15
111 0.09
112 0.08
113 0.09
114 0.09
115 0.15
116 0.17
117 0.2
118 0.22
119 0.21
120 0.22
121 0.24
122 0.24
123 0.2
124 0.18
125 0.16
126 0.16
127 0.16
128 0.15
129 0.12
130 0.09
131 0.07
132 0.06
133 0.05
134 0.04
135 0.04
136 0.04
137 0.04
138 0.04
139 0.04
140 0.04
141 0.05
142 0.05
143 0.09
144 0.09
145 0.1
146 0.1
147 0.12
148 0.13
149 0.16
150 0.16
151 0.12
152 0.14
153 0.15
154 0.17
155 0.16
156 0.18
157 0.17
158 0.17
159 0.17
160 0.16
161 0.14
162 0.12
163 0.11
164 0.09
165 0.07
166 0.06
167 0.07
168 0.07
169 0.12
170 0.14
171 0.17
172 0.17
173 0.23
174 0.26
175 0.25
176 0.27
177 0.25
178 0.25
179 0.22
180 0.21
181 0.15
182 0.12
183 0.13
184 0.11
185 0.09
186 0.13
187 0.17
188 0.25
189 0.31
190 0.37
191 0.46
192 0.55
193 0.64
194 0.69
195 0.77
196 0.77
197 0.78
198 0.83
199 0.8
200 0.8
201 0.73
202 0.65
203 0.56
204 0.48
205 0.41
206 0.31
207 0.27
208 0.2
209 0.17
210 0.16
211 0.16
212 0.18
213 0.21
214 0.23
215 0.26
216 0.26
217 0.28
218 0.32
219 0.34
220 0.34
221 0.31
222 0.28
223 0.23
224 0.21
225 0.18
226 0.18
227 0.14
228 0.13
229 0.13
230 0.15
231 0.17