Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

F8PXB8

Protein Details
Accession F8PXB8    Localization Confidence Low Confidence Score 6
NoLS Segment(s)
PositionSequenceProtein Nature
37-56LQKCWRCKLRAIKRCCRTDKHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 21, nucl 3, cyto 3, cyto_nucl 3
Family & Domain DBs
Amino Acid Sequences MSCGSPSSPLHIQRLTPRALIKAVKIEGVDNGYLLHLQKCWRCKLRAIKRCCRTDKVHILDHMGLPFVLGHLKFTGW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.41
3 0.38
4 0.36
5 0.32
6 0.34
7 0.33
8 0.27
9 0.28
10 0.25
11 0.24
12 0.22
13 0.2
14 0.18
15 0.18
16 0.16
17 0.1
18 0.09
19 0.08
20 0.08
21 0.08
22 0.07
23 0.07
24 0.1
25 0.13
26 0.17
27 0.23
28 0.28
29 0.29
30 0.36
31 0.46
32 0.54
33 0.6
34 0.66
35 0.7
36 0.73
37 0.81
38 0.79
39 0.74
40 0.7
41 0.71
42 0.72
43 0.67
44 0.64
45 0.57
46 0.55
47 0.51
48 0.46
49 0.37
50 0.27
51 0.21
52 0.15
53 0.14
54 0.1
55 0.12
56 0.1
57 0.11