Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

F8Q4W7

Protein Details
Accession F8Q4W7    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
62-81AYRDCKKTWLDQRKADRRAGHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 17, cyto 4, pero 3, mito 1, golg 1, vacu 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR009069  Cys_alpha_HP_mot_SF  
PROSITE View protein in PROSITE  
PS51808  CHCH  
Amino Acid Sequences MSTKESESPQDNVQPLNYREHFAGRETYTKHTDPCESAAKASMACMDRNSYDRDKCLDFFQAYRDCKKTWLDQRKADRRAGRDASL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.33
3 0.38
4 0.35
5 0.31
6 0.31
7 0.33
8 0.31
9 0.26
10 0.29
11 0.22
12 0.26
13 0.27
14 0.3
15 0.32
16 0.32
17 0.31
18 0.29
19 0.29
20 0.25
21 0.27
22 0.27
23 0.23
24 0.22
25 0.22
26 0.2
27 0.18
28 0.16
29 0.16
30 0.12
31 0.12
32 0.12
33 0.12
34 0.12
35 0.14
36 0.19
37 0.2
38 0.2
39 0.22
40 0.24
41 0.25
42 0.25
43 0.25
44 0.25
45 0.22
46 0.21
47 0.25
48 0.31
49 0.32
50 0.36
51 0.37
52 0.33
53 0.36
54 0.39
55 0.43
56 0.46
57 0.54
58 0.56
59 0.62
60 0.73
61 0.79
62 0.81
63 0.8
64 0.76
65 0.7
66 0.71