Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F8PM80

Protein Details
Accession F8PM80   
Localization Confidence Medium
Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
43-65QYSAPKASTHRPKKPPPPRHTPSHydrophilic
NLS Segment(s)
PositionSequence
53-60RPKKPPPP
Subcellular Location(s) nucl 13.5, mito 13, cyto_nucl 7.5
Family & Domain DBs
Amino Acid Sequences GTIQSFFLYVHLKCPINTALPKHTKTPRNPALSSSSSRTVKNQYSAPKASTHRPKKPPPPRHTPSDRQESINKYHQETPKQYKYINTPR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.26
3 0.28
4 0.32
5 0.33
6 0.37
7 0.43
8 0.45
9 0.48
10 0.54
11 0.56
12 0.59
13 0.65
14 0.64
15 0.63
16 0.62
17 0.58
18 0.56
19 0.51
20 0.48
21 0.41
22 0.39
23 0.34
24 0.34
25 0.34
26 0.33
27 0.32
28 0.31
29 0.32
30 0.31
31 0.35
32 0.36
33 0.34
34 0.34
35 0.33
36 0.39
37 0.45
38 0.49
39 0.53
40 0.59
41 0.67
42 0.73
43 0.82
44 0.84
45 0.81
46 0.82
47 0.78
48 0.79
49 0.79
50 0.77
51 0.74
52 0.73
53 0.68
54 0.62
55 0.63
56 0.59
57 0.57
58 0.56
59 0.51
60 0.46
61 0.51
62 0.53
63 0.56
64 0.6
65 0.64
66 0.64
67 0.65
68 0.63
69 0.61