Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

F8Q9F0

Protein Details
Accession F8Q9F0    Localization Confidence Medium Confidence Score 10.9
NoLS Segment(s)
PositionSequenceProtein Nature
43-64LLRPHQARKRKLKVPHPPRSTTBasic
NLS Segment(s)
PositionSequence
50-55RKRKLK
Subcellular Location(s) nucl 8, mito 8, mito_nucl 8, cyto 4
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MFNGSEDVDMQRKWFIVSLTNKYSYFYGIACLVKTSFILYPVLLRPHQARKRKLKVPHPPRSTTLSTSKHYLLVFHLRLSHV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.15
3 0.19
4 0.26
5 0.32
6 0.35
7 0.38
8 0.37
9 0.37
10 0.36
11 0.3
12 0.24
13 0.17
14 0.14
15 0.13
16 0.14
17 0.12
18 0.13
19 0.11
20 0.1
21 0.1
22 0.1
23 0.07
24 0.08
25 0.08
26 0.07
27 0.09
28 0.1
29 0.13
30 0.11
31 0.13
32 0.16
33 0.25
34 0.33
35 0.4
36 0.48
37 0.56
38 0.65
39 0.71
40 0.76
41 0.76
42 0.8
43 0.82
44 0.84
45 0.81
46 0.76
47 0.72
48 0.7
49 0.64
50 0.57
51 0.56
52 0.5
53 0.47
54 0.46
55 0.44
56 0.41
57 0.37
58 0.33
59 0.29
60 0.33
61 0.32
62 0.29