Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F8PVW7

Protein Details
Accession F8PVW7   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
1-50RWRRLPVWWRRRLRWRKLRWWWLWRSGWLRPRRLWRWRRIRRSGRLWLPGHydrophilic
NLS Segment(s)
PositionSequence
9-55WRRRLRWRKLRWWWLWRSGWLRPRRLWRWRRIRRSGRLWLPGARWLR
Subcellular Location(s) plas 16, mito 5, E.R. 3, cyto_mito 3
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences RWRRLPVWWRRRLRWRKLRWWWLWRSGWLRPRRLWRWRRIRRSGRLWLPGARWLRRWRLLKCPCHLQLPIIFLVIFVFLTHSSTQDSYHHCLSFLSEHLSFLSLACVPSLGFTTIRLVLV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.89
2 0.88
3 0.89
4 0.91
5 0.93
6 0.91
7 0.9
8 0.86
9 0.84
10 0.78
11 0.74
12 0.69
13 0.66
14 0.64
15 0.62
16 0.62
17 0.58
18 0.65
19 0.66
20 0.71
21 0.73
22 0.75
23 0.79
24 0.83
25 0.87
26 0.88
27 0.89
28 0.87
29 0.87
30 0.86
31 0.81
32 0.77
33 0.69
34 0.62
35 0.53
36 0.5
37 0.47
38 0.39
39 0.37
40 0.36
41 0.39
42 0.44
43 0.49
44 0.45
45 0.5
46 0.58
47 0.59
48 0.57
49 0.59
50 0.53
51 0.51
52 0.48
53 0.39
54 0.33
55 0.29
56 0.26
57 0.18
58 0.16
59 0.12
60 0.12
61 0.1
62 0.07
63 0.04
64 0.05
65 0.04
66 0.07
67 0.07
68 0.08
69 0.09
70 0.1
71 0.12
72 0.15
73 0.19
74 0.22
75 0.25
76 0.25
77 0.23
78 0.23
79 0.23
80 0.22
81 0.19
82 0.19
83 0.16
84 0.16
85 0.16
86 0.17
87 0.15
88 0.13
89 0.13
90 0.1
91 0.1
92 0.09
93 0.09
94 0.08
95 0.09
96 0.11
97 0.1
98 0.1
99 0.1
100 0.14