Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q0V096

Protein Details
Accession Q0V096    Localization Confidence Low Confidence Score 9.3
NoLS Segment(s)
PositionSequenceProtein Nature
47-73RYPSKVTRRMSKNKQAKKSKVKPFVKQHydrophilic
NLS Segment(s)
PositionSequence
54-68RRMSKNKQAKKSKVK
Subcellular Location(s) mito 21, nucl 3.5, cyto_nucl 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR005824  KOW  
IPR041991  KOW_RPL27  
IPR038655  L27e_sf  
IPR001141  Ribosomal_L27e  
IPR008991  Translation_prot_SH3-like_sf  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG pno:SNOG_02568  -  
Pfam View protein in Pfam  
PF01777  Ribosomal_L27e  
CDD cd06090  KOW_RPL27  
Amino Acid Sequences MKFLKVGRVVIITRGRYAGKKCVIISPLDNGTKSHPFPHALVAGIERYPSKVTRRMSKNKQAKKSKVKPFVKQVNYTHLMPTRYTIELDNLKGVLAADTFKEVSQREEAKKTVKKAFEERYQSGKNRWFFTPLQF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.33
3 0.33
4 0.37
5 0.38
6 0.37
7 0.39
8 0.39
9 0.42
10 0.41
11 0.39
12 0.36
13 0.32
14 0.33
15 0.31
16 0.3
17 0.25
18 0.28
19 0.31
20 0.3
21 0.28
22 0.25
23 0.25
24 0.26
25 0.29
26 0.25
27 0.2
28 0.2
29 0.18
30 0.16
31 0.14
32 0.13
33 0.1
34 0.1
35 0.11
36 0.13
37 0.16
38 0.22
39 0.25
40 0.34
41 0.43
42 0.52
43 0.59
44 0.67
45 0.73
46 0.75
47 0.82
48 0.82
49 0.83
50 0.84
51 0.85
52 0.84
53 0.85
54 0.82
55 0.78
56 0.78
57 0.78
58 0.71
59 0.68
60 0.6
61 0.57
62 0.54
63 0.49
64 0.42
65 0.36
66 0.32
67 0.25
68 0.25
69 0.21
70 0.18
71 0.18
72 0.16
73 0.17
74 0.19
75 0.19
76 0.18
77 0.15
78 0.14
79 0.14
80 0.13
81 0.09
82 0.06
83 0.06
84 0.05
85 0.07
86 0.08
87 0.08
88 0.11
89 0.11
90 0.14
91 0.2
92 0.26
93 0.29
94 0.33
95 0.36
96 0.42
97 0.48
98 0.52
99 0.53
100 0.52
101 0.54
102 0.58
103 0.64
104 0.64
105 0.66
106 0.64
107 0.65
108 0.66
109 0.65
110 0.64
111 0.63
112 0.6
113 0.55
114 0.53
115 0.5