Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F8PT15

Protein Details
Accession F8PT15    Localization Confidence High Confidence Score 17.2
NoLS Segment(s)
PositionSequenceProtein Nature
75-99LVKQYLSNRRKNKSRKERKGVASTSHydrophilic
NLS Segment(s)
PositionSequence
83-93RRKNKSRKERK
Subcellular Location(s) nucl 23, mito 2
Family & Domain DBs
Amino Acid Sequences MTNKLTMNFLHSIIAEFNGHNTRLLGTITVDDEKRPDRSQAKNQPEKELGDLFRLARHYHPYLARFQNDWATSELVKQYLSNRRKNKSRKERKGVASTSPPDIDHLKREGEQEQEQEQPRDGANTGNIDENWE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.14
3 0.12
4 0.16
5 0.18
6 0.18
7 0.17
8 0.17
9 0.15
10 0.15
11 0.16
12 0.12
13 0.1
14 0.11
15 0.12
16 0.14
17 0.14
18 0.13
19 0.16
20 0.18
21 0.22
22 0.22
23 0.27
24 0.31
25 0.38
26 0.49
27 0.56
28 0.64
29 0.68
30 0.69
31 0.68
32 0.64
33 0.57
34 0.49
35 0.43
36 0.33
37 0.26
38 0.26
39 0.2
40 0.19
41 0.19
42 0.17
43 0.14
44 0.19
45 0.18
46 0.21
47 0.24
48 0.24
49 0.29
50 0.32
51 0.31
52 0.27
53 0.27
54 0.28
55 0.25
56 0.25
57 0.19
58 0.17
59 0.16
60 0.16
61 0.16
62 0.11
63 0.11
64 0.1
65 0.14
66 0.23
67 0.3
68 0.37
69 0.44
70 0.51
71 0.61
72 0.7
73 0.75
74 0.77
75 0.82
76 0.84
77 0.86
78 0.88
79 0.87
80 0.87
81 0.78
82 0.73
83 0.7
84 0.62
85 0.56
86 0.47
87 0.39
88 0.33
89 0.34
90 0.3
91 0.25
92 0.25
93 0.24
94 0.25
95 0.28
96 0.28
97 0.3
98 0.31
99 0.31
100 0.32
101 0.36
102 0.39
103 0.38
104 0.36
105 0.32
106 0.28
107 0.27
108 0.24
109 0.2
110 0.19
111 0.21
112 0.21
113 0.23