Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F8PVL8

Protein Details
Accession F8PVL8    Localization Confidence Medium Confidence Score 14.1
NoLS Segment(s)
PositionSequenceProtein Nature
16-38RYQAHPKPPKHSKKSKGTTNIKGBasic
NLS Segment(s)
PositionSequence
21-51PKPPKHSKKSKGTTNIKGLPPAKKSKGRSGR
Subcellular Location(s) nucl 21.5, cyto_nucl 12, mito 2
Family & Domain DBs
Amino Acid Sequences MKVYAQGCDWHEKFLRYQAHPKPPKHSKKSKGTTNIKGLPPAKKSKGRSGRTAIKYSDTSDSDTKDEFDSEDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.43
3 0.38
4 0.47
5 0.5
6 0.58
7 0.65
8 0.66
9 0.68
10 0.71
11 0.77
12 0.77
13 0.79
14 0.77
15 0.8
16 0.85
17 0.84
18 0.84
19 0.81
20 0.79
21 0.76
22 0.73
23 0.63
24 0.6
25 0.54
26 0.49
27 0.45
28 0.45
29 0.43
30 0.44
31 0.48
32 0.53
33 0.61
34 0.6
35 0.62
36 0.64
37 0.67
38 0.66
39 0.67
40 0.58
41 0.52
42 0.49
43 0.45
44 0.42
45 0.34
46 0.32
47 0.3
48 0.32
49 0.29
50 0.29
51 0.27
52 0.23
53 0.22