Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q0UBY0

Protein Details
Accession Q0UBY0   
Localization Confidence Medium
Confidence Score 12.2
NoLS Segment(s)
PositionSequenceProtein Nature
266-301MLLISVKRQRKLKMKKHKYKKLMKRTRLERRKLDRTBasic
NLS Segment(s)
PositionSequence
263-263R
269-300ISVKRQRKLKMKKHKYKKLMKRTRLERRKLDR
Subcellular Location(s) mito 15.5, mito_nucl 13.333, nucl 10, cyto_nucl 6.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR013177  COX24_C  
Gene Ontology GO:0005739  C:mitochondrion  
KEGG pno:SNOG_10734  -  
Pfam View protein in Pfam  
PF08213  COX24_C  
Amino Acid Sequences MFAPSFARAARSTTSISTTPASSLCRASLTTASKSLHQRRYSSSKSSIPPSNKKKPVEELEQNAPTQLQDPKTGAELDKDEVKKIPFASSADNVPHAPPTTHLHEDDVRLSTFFAMHQPISFHREAWQQSVTSMGAIDDLFNTELNGYRMKAIQKTESTLTEFLQRVSARMDIINHFEEQKASEAMQESDIFGEPQPQTEESIMHYASKLLPFIPPPPPLALDSFAQQSVHAQEVNERITEVDLPVEQTQRPATFREHVHRRRGGMLLISVKRQRKLKMKKHKYKKLMKRTRLERRKLDRT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.26
3 0.28
4 0.26
5 0.24
6 0.22
7 0.22
8 0.23
9 0.21
10 0.22
11 0.2
12 0.2
13 0.2
14 0.21
15 0.25
16 0.27
17 0.28
18 0.31
19 0.32
20 0.36
21 0.46
22 0.52
23 0.54
24 0.55
25 0.55
26 0.58
27 0.66
28 0.66
29 0.63
30 0.6
31 0.58
32 0.58
33 0.61
34 0.61
35 0.61
36 0.66
37 0.69
38 0.73
39 0.74
40 0.73
41 0.72
42 0.72
43 0.7
44 0.69
45 0.67
46 0.63
47 0.63
48 0.61
49 0.55
50 0.47
51 0.4
52 0.3
53 0.25
54 0.24
55 0.18
56 0.18
57 0.19
58 0.19
59 0.21
60 0.22
61 0.2
62 0.18
63 0.18
64 0.17
65 0.24
66 0.23
67 0.23
68 0.24
69 0.25
70 0.24
71 0.23
72 0.23
73 0.18
74 0.2
75 0.22
76 0.21
77 0.23
78 0.22
79 0.22
80 0.21
81 0.19
82 0.19
83 0.15
84 0.14
85 0.14
86 0.17
87 0.21
88 0.23
89 0.23
90 0.25
91 0.26
92 0.27
93 0.26
94 0.24
95 0.18
96 0.16
97 0.15
98 0.12
99 0.11
100 0.09
101 0.09
102 0.09
103 0.09
104 0.1
105 0.11
106 0.13
107 0.18
108 0.18
109 0.16
110 0.17
111 0.22
112 0.23
113 0.25
114 0.24
115 0.19
116 0.18
117 0.2
118 0.17
119 0.11
120 0.1
121 0.07
122 0.06
123 0.06
124 0.06
125 0.04
126 0.05
127 0.05
128 0.05
129 0.05
130 0.05
131 0.06
132 0.07
133 0.08
134 0.07
135 0.08
136 0.1
137 0.12
138 0.15
139 0.15
140 0.18
141 0.18
142 0.21
143 0.21
144 0.21
145 0.21
146 0.19
147 0.18
148 0.19
149 0.19
150 0.16
151 0.19
152 0.18
153 0.16
154 0.16
155 0.17
156 0.12
157 0.13
158 0.14
159 0.11
160 0.15
161 0.15
162 0.14
163 0.14
164 0.14
165 0.13
166 0.13
167 0.13
168 0.1
169 0.09
170 0.1
171 0.11
172 0.11
173 0.12
174 0.11
175 0.1
176 0.1
177 0.1
178 0.09
179 0.08
180 0.13
181 0.11
182 0.12
183 0.14
184 0.14
185 0.15
186 0.15
187 0.16
188 0.12
189 0.15
190 0.14
191 0.13
192 0.12
193 0.12
194 0.13
195 0.13
196 0.11
197 0.09
198 0.1
199 0.11
200 0.15
201 0.19
202 0.2
203 0.21
204 0.22
205 0.23
206 0.23
207 0.24
208 0.22
209 0.17
210 0.18
211 0.17
212 0.16
213 0.15
214 0.13
215 0.13
216 0.13
217 0.14
218 0.13
219 0.11
220 0.15
221 0.19
222 0.2
223 0.18
224 0.17
225 0.15
226 0.16
227 0.16
228 0.12
229 0.1
230 0.09
231 0.12
232 0.14
233 0.16
234 0.15
235 0.16
236 0.2
237 0.21
238 0.22
239 0.22
240 0.25
241 0.29
242 0.34
243 0.42
244 0.5
245 0.55
246 0.63
247 0.65
248 0.63
249 0.62
250 0.58
251 0.51
252 0.43
253 0.41
254 0.4
255 0.37
256 0.41
257 0.44
258 0.47
259 0.5
260 0.53
261 0.56
262 0.58
263 0.67
264 0.71
265 0.75
266 0.82
267 0.87
268 0.92
269 0.95
270 0.95
271 0.95
272 0.95
273 0.95
274 0.94
275 0.93
276 0.93
277 0.93
278 0.94
279 0.93
280 0.92
281 0.91