Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

F8PVN4

Protein Details
Accession F8PVN4    Localization Confidence Low Confidence Score 7.8
NoLS Segment(s)
PositionSequenceProtein Nature
39-62YQSKERQCWRAWKRKFQRWSRLAVHydrophilic
NLS Segment(s)
Subcellular Location(s) mito_nucl 12.833, nucl 12.5, mito 11, cyto_nucl 8.666
Family & Domain DBs
Amino Acid Sequences MTITAQTKRRAGMMTFREQRRDFLPRRSKSVLIVLSQDYQSKERQCWRAWKRKFQRWSRLAV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.49
3 0.5
4 0.55
5 0.52
6 0.52
7 0.48
8 0.5
9 0.44
10 0.46
11 0.54
12 0.49
13 0.56
14 0.57
15 0.53
16 0.45
17 0.48
18 0.39
19 0.29
20 0.29
21 0.23
22 0.21
23 0.21
24 0.21
25 0.16
26 0.16
27 0.2
28 0.21
29 0.24
30 0.31
31 0.36
32 0.39
33 0.49
34 0.57
35 0.63
36 0.69
37 0.76
38 0.78
39 0.82
40 0.88
41 0.88
42 0.89