Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F8PJC8

Protein Details
Accession F8PJC8    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
160-195MRDMGKRITRFKQHYKRRRPHPLKPPRTSKSQKLPFBasic
NLS Segment(s)
PositionSequence
135-192GKKRMFKGHKWERVLEGKTKRKAMLMRDMGKRITRFKQHYKRRRPHPLKPPRTSKSQK
Subcellular Location(s) mito 17.5, mito_nucl 12.833, nucl 7, cyto_nucl 5.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR037507  MrpL25  
IPR040922  MRPL25_dom  
Gene Ontology GO:0005762  C:mitochondrial large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
Pfam View protein in Pfam  
PF18126  Mitoc_mL59  
Amino Acid Sequences MALQAVKKFRIKELKAISPRNISPSQSTPKPSLPNAVTRSNPFLPHRNPNTGRWIPPKYSLRQQADLVKKAKQTNTLALIPPGPKLSVLEATVARQHSLPVSVRPQPWSKPVEWEGQVKERVVPGADIGNRLYAGKKRMFKGHKWERVLEGKTKRKAMLMRDMGKRITRFKQHYKRRRPHPLKPPRTSKSQKLPF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.67
3 0.72
4 0.69
5 0.65
6 0.64
7 0.61
8 0.55
9 0.47
10 0.44
11 0.45
12 0.48
13 0.46
14 0.48
15 0.46
16 0.49
17 0.52
18 0.48
19 0.48
20 0.43
21 0.46
22 0.47
23 0.48
24 0.45
25 0.43
26 0.48
27 0.42
28 0.44
29 0.4
30 0.43
31 0.44
32 0.51
33 0.53
34 0.56
35 0.57
36 0.56
37 0.61
38 0.57
39 0.57
40 0.55
41 0.54
42 0.47
43 0.52
44 0.54
45 0.49
46 0.54
47 0.57
48 0.55
49 0.53
50 0.54
51 0.54
52 0.55
53 0.56
54 0.5
55 0.44
56 0.43
57 0.44
58 0.43
59 0.41
60 0.37
61 0.36
62 0.38
63 0.37
64 0.33
65 0.29
66 0.29
67 0.23
68 0.21
69 0.16
70 0.12
71 0.09
72 0.09
73 0.1
74 0.1
75 0.1
76 0.11
77 0.1
78 0.11
79 0.14
80 0.13
81 0.12
82 0.1
83 0.1
84 0.08
85 0.11
86 0.11
87 0.11
88 0.14
89 0.18
90 0.2
91 0.23
92 0.25
93 0.25
94 0.29
95 0.3
96 0.27
97 0.28
98 0.3
99 0.32
100 0.32
101 0.34
102 0.31
103 0.33
104 0.34
105 0.28
106 0.27
107 0.22
108 0.2
109 0.16
110 0.14
111 0.09
112 0.12
113 0.12
114 0.13
115 0.12
116 0.12
117 0.12
118 0.13
119 0.14
120 0.13
121 0.18
122 0.23
123 0.28
124 0.31
125 0.4
126 0.45
127 0.49
128 0.57
129 0.63
130 0.65
131 0.64
132 0.64
133 0.61
134 0.64
135 0.61
136 0.58
137 0.57
138 0.57
139 0.59
140 0.61
141 0.55
142 0.53
143 0.54
144 0.52
145 0.53
146 0.53
147 0.55
148 0.57
149 0.59
150 0.57
151 0.58
152 0.55
153 0.51
154 0.5
155 0.52
156 0.54
157 0.62
158 0.7
159 0.76
160 0.83
161 0.87
162 0.89
163 0.9
164 0.94
165 0.92
166 0.92
167 0.92
168 0.92
169 0.92
170 0.92
171 0.92
172 0.85
173 0.86
174 0.84
175 0.83