Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F8QFD1

Protein Details
Accession F8QFD1   
Localization Confidence Low
Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
115-146EEIIMPPKRKRGRARLVVKPQEKKKIIKRARNBasic
NLS Segment(s)
PositionSequence
121-146PKRKRGRARLVVKPQEKKKIIKRARN
Subcellular Location(s) mito 20, nucl 5.5, cyto_nucl 5
Family & Domain DBs
Amino Acid Sequences MERQIAPRVAAVSHIRSSPPLSSPPCSRSTPAPSPSQTPPSCAVMPPPPARLHLVSVPPRPVPPSSPPCETPAGSPPLKFPESPVAPHVKPSPKPKVPILKKVTEDSDSTLTEEEEIIMPPKRKRGRARLVVKPQEKKKIIKRARN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.24
3 0.25
4 0.28
5 0.25
6 0.24
7 0.27
8 0.29
9 0.33
10 0.37
11 0.4
12 0.42
13 0.42
14 0.41
15 0.41
16 0.45
17 0.48
18 0.47
19 0.49
20 0.47
21 0.49
22 0.51
23 0.53
24 0.45
25 0.4
26 0.39
27 0.37
28 0.36
29 0.31
30 0.3
31 0.26
32 0.32
33 0.31
34 0.32
35 0.28
36 0.29
37 0.32
38 0.29
39 0.26
40 0.23
41 0.28
42 0.3
43 0.32
44 0.32
45 0.3
46 0.29
47 0.29
48 0.26
49 0.23
50 0.26
51 0.3
52 0.31
53 0.34
54 0.35
55 0.36
56 0.37
57 0.34
58 0.28
59 0.25
60 0.26
61 0.23
62 0.22
63 0.2
64 0.22
65 0.23
66 0.21
67 0.19
68 0.22
69 0.23
70 0.24
71 0.26
72 0.27
73 0.26
74 0.29
75 0.33
76 0.31
77 0.35
78 0.42
79 0.49
80 0.47
81 0.51
82 0.56
83 0.61
84 0.61
85 0.66
86 0.64
87 0.6
88 0.59
89 0.58
90 0.54
91 0.46
92 0.4
93 0.34
94 0.31
95 0.25
96 0.23
97 0.2
98 0.17
99 0.15
100 0.14
101 0.11
102 0.08
103 0.08
104 0.1
105 0.14
106 0.19
107 0.21
108 0.31
109 0.37
110 0.45
111 0.55
112 0.63
113 0.69
114 0.75
115 0.82
116 0.83
117 0.87
118 0.89
119 0.88
120 0.87
121 0.84
122 0.84
123 0.82
124 0.8
125 0.79
126 0.8