Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

F8PS38

Protein Details
Accession F8PS38    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MSNPPLKRRTRKRLDDGVDKLWHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 14.5, mito_nucl 14, nucl 12.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036047  F-box-like_dom_sf  
CDD cd09917  F-box_SF  
Amino Acid Sequences MSNPPLKRRTRKRLDDGVDKLWKLSNVNKSRDSFSALNFDVIFHLCTFLHPMDLLNLARTSKPFRQLLMSKSSAFIWKFSRLQVEDMPQCPPDLNEPQYANLAFGLYCQNCGKVGQCLFWQFRARYCTSCVKIW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.87
2 0.86
3 0.81
4 0.79
5 0.74
6 0.64
7 0.55
8 0.47
9 0.41
10 0.34
11 0.36
12 0.37
13 0.39
14 0.44
15 0.49
16 0.49
17 0.51
18 0.49
19 0.48
20 0.39
21 0.33
22 0.34
23 0.29
24 0.28
25 0.24
26 0.23
27 0.18
28 0.17
29 0.16
30 0.09
31 0.1
32 0.08
33 0.08
34 0.11
35 0.1
36 0.1
37 0.09
38 0.09
39 0.09
40 0.11
41 0.11
42 0.09
43 0.1
44 0.1
45 0.1
46 0.12
47 0.16
48 0.16
49 0.22
50 0.22
51 0.22
52 0.28
53 0.3
54 0.32
55 0.33
56 0.32
57 0.26
58 0.26
59 0.26
60 0.24
61 0.21
62 0.21
63 0.18
64 0.2
65 0.21
66 0.22
67 0.26
68 0.23
69 0.26
70 0.26
71 0.29
72 0.27
73 0.27
74 0.28
75 0.23
76 0.22
77 0.19
78 0.18
79 0.17
80 0.2
81 0.21
82 0.24
83 0.25
84 0.26
85 0.28
86 0.28
87 0.23
88 0.17
89 0.15
90 0.1
91 0.1
92 0.15
93 0.12
94 0.16
95 0.16
96 0.16
97 0.17
98 0.18
99 0.19
100 0.2
101 0.21
102 0.21
103 0.24
104 0.3
105 0.32
106 0.37
107 0.43
108 0.37
109 0.41
110 0.45
111 0.45
112 0.41
113 0.44
114 0.48