Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F8PGY7

Protein Details
Accession F8PGY7    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-25ITTFRRRCRIFQRRPKKDKLCAIFYHydrophilic
NLS Segment(s)
PositionSequence
28-44RRSRGLPDRLAREPSRR
Subcellular Location(s) nucl 11.5, mito 10, cyto_nucl 9, cyto 5.5
Family & Domain DBs
Amino Acid Sequences ITTFRRRCRIFQRRPKKDKLCAIFYERRRSRGLPDRLAREPSRRPTAGARYYKHIRKLAVFCGQNGRKVQGQL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.9
2 0.93
3 0.91
4 0.89
5 0.87
6 0.82
7 0.78
8 0.71
9 0.7
10 0.68
11 0.65
12 0.66
13 0.59
14 0.56
15 0.52
16 0.49
17 0.49
18 0.51
19 0.52
20 0.5
21 0.52
22 0.53
23 0.52
24 0.56
25 0.5
26 0.45
27 0.44
28 0.42
29 0.44
30 0.4
31 0.39
32 0.41
33 0.48
34 0.51
35 0.52
36 0.47
37 0.48
38 0.56
39 0.6
40 0.61
41 0.56
42 0.5
43 0.5
44 0.53
45 0.52
46 0.52
47 0.48
48 0.43
49 0.49
50 0.49
51 0.48
52 0.46
53 0.43