Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F8QJ07

Protein Details
Accession F8QJ07   
Localization Confidence Medium
Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
44-73RLCIRPPRSRREQTRPRRTRARARAISRPCHydrophilic
NLS Segment(s)
PositionSequence
49-68PPRSRREQTRPRRTRARARA
Subcellular Location(s) nucl 16, cyto_nucl 10.5, mito 7, cyto 3
Family & Domain DBs
Amino Acid Sequences MLLSTKSPLTTRGSTIPPYQCSIPPLSFGALALETIIPRRFDVRLCIRPPRSRREQTRPRRTRARARAISRPCPPCRGHVDCQTSHSRC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.4
3 0.42
4 0.38
5 0.39
6 0.37
7 0.34
8 0.33
9 0.34
10 0.27
11 0.24
12 0.22
13 0.2
14 0.18
15 0.16
16 0.14
17 0.1
18 0.09
19 0.07
20 0.06
21 0.05
22 0.08
23 0.09
24 0.08
25 0.09
26 0.11
27 0.11
28 0.11
29 0.18
30 0.24
31 0.3
32 0.32
33 0.4
34 0.44
35 0.51
36 0.55
37 0.57
38 0.58
39 0.6
40 0.66
41 0.69
42 0.75
43 0.78
44 0.85
45 0.85
46 0.83
47 0.85
48 0.83
49 0.84
50 0.83
51 0.83
52 0.81
53 0.78
54 0.8
55 0.78
56 0.78
57 0.76
58 0.74
59 0.67
60 0.65
61 0.61
62 0.58
63 0.59
64 0.58
65 0.57
66 0.58
67 0.62
68 0.57
69 0.61