Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

F8PGF4

Protein Details
Accession F8PGF4    Localization Confidence High Confidence Score 15.3
NoLS Segment(s)
PositionSequenceProtein Nature
85-111LKSSMTTLRKRDKKREKQRAEELARRKBasic
119-146VVEGPKRGNGRRKRQRKMKAIVKQEELKBasic
NLS Segment(s)
PositionSequence
93-153RKRDKKREKQRAEELARRKRRMAEQIVVEGPKRGNGRRKRQRKMKAIVKQEELKERVRARD
Subcellular Location(s) nucl 17, mito 5, cyto 5, cyto_mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR003210  Signal_recog_particle_SRP14  
IPR009018  Signal_recog_particle_SRP9/14  
Gene Ontology GO:0005786  C:signal recognition particle, endoplasmic reticulum targeting  
GO:0008312  F:7S RNA binding  
GO:0030942  F:endoplasmic reticulum signal peptide binding  
GO:0006614  P:SRP-dependent cotranslational protein targeting to membrane  
Pfam View protein in Pfam  
PF02290  SRP14  
Amino Acid Sequences MQLVDNSTFLTRLAAEFESHKEKGTIWLTHKRLTHDGEDATMNDADGTREYPCLVRATDGKKVKFSTQVESKDLMKFHSAYGSLLKSSMTTLRKRDKKREKQRAEELARRKRRMAEQIVVEGPKRGNGRRKRQRKMKAIVKQEELKERVRARDEAKARSVST
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.13
3 0.15
4 0.2
5 0.25
6 0.25
7 0.25
8 0.23
9 0.22
10 0.29
11 0.32
12 0.33
13 0.33
14 0.43
15 0.45
16 0.5
17 0.52
18 0.49
19 0.49
20 0.47
21 0.44
22 0.38
23 0.35
24 0.31
25 0.29
26 0.25
27 0.22
28 0.18
29 0.14
30 0.11
31 0.1
32 0.09
33 0.08
34 0.09
35 0.07
36 0.08
37 0.08
38 0.09
39 0.1
40 0.12
41 0.11
42 0.12
43 0.17
44 0.2
45 0.28
46 0.34
47 0.33
48 0.35
49 0.37
50 0.37
51 0.4
52 0.37
53 0.36
54 0.38
55 0.4
56 0.39
57 0.39
58 0.38
59 0.33
60 0.31
61 0.25
62 0.19
63 0.16
64 0.14
65 0.14
66 0.13
67 0.11
68 0.13
69 0.12
70 0.1
71 0.1
72 0.09
73 0.08
74 0.08
75 0.13
76 0.15
77 0.18
78 0.25
79 0.35
80 0.43
81 0.5
82 0.6
83 0.66
84 0.73
85 0.81
86 0.86
87 0.85
88 0.86
89 0.89
90 0.88
91 0.84
92 0.81
93 0.8
94 0.79
95 0.79
96 0.73
97 0.66
98 0.61
99 0.61
100 0.62
101 0.59
102 0.55
103 0.49
104 0.5
105 0.51
106 0.46
107 0.39
108 0.32
109 0.25
110 0.24
111 0.24
112 0.26
113 0.33
114 0.42
115 0.53
116 0.62
117 0.73
118 0.79
119 0.86
120 0.9
121 0.91
122 0.91
123 0.9
124 0.89
125 0.88
126 0.85
127 0.81
128 0.78
129 0.73
130 0.71
131 0.65
132 0.59
133 0.57
134 0.54
135 0.54
136 0.52
137 0.52
138 0.47
139 0.54
140 0.56
141 0.55
142 0.56