Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F8Q0W8

Protein Details
Accession F8Q0W8    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
66-92LRPPAAQSVTRRRRRRQRRGTWVDTLPHydrophilic
NLS Segment(s)
PositionSequence
76-84RRRRRRQRR
Subcellular Location(s) plas 18, mito 3, E.R. 2, cyto_mito 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MASTSVVSSPVTQLTSKIQWNTIVGIILGLVCFLSMIFFLHRVQQTGMGLTWILRVFRPFRDLASLRPPAAQSVTRRRRRRQRRGTWVDTLPVTLRPTFEPSPPPYAMADPRPSVFLEDAQRGVTTSRT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.24
3 0.28
4 0.28
5 0.28
6 0.28
7 0.29
8 0.29
9 0.24
10 0.2
11 0.15
12 0.12
13 0.1
14 0.08
15 0.07
16 0.05
17 0.03
18 0.03
19 0.03
20 0.03
21 0.03
22 0.03
23 0.04
24 0.05
25 0.06
26 0.07
27 0.13
28 0.14
29 0.15
30 0.15
31 0.17
32 0.16
33 0.16
34 0.16
35 0.1
36 0.1
37 0.08
38 0.1
39 0.08
40 0.08
41 0.07
42 0.1
43 0.11
44 0.12
45 0.16
46 0.14
47 0.14
48 0.2
49 0.21
50 0.21
51 0.26
52 0.27
53 0.24
54 0.25
55 0.25
56 0.19
57 0.2
58 0.21
59 0.2
60 0.29
61 0.39
62 0.47
63 0.55
64 0.64
65 0.73
66 0.81
67 0.86
68 0.86
69 0.87
70 0.89
71 0.91
72 0.88
73 0.84
74 0.74
75 0.66
76 0.55
77 0.45
78 0.35
79 0.28
80 0.24
81 0.17
82 0.17
83 0.16
84 0.22
85 0.23
86 0.24
87 0.28
88 0.3
89 0.36
90 0.35
91 0.34
92 0.29
93 0.32
94 0.34
95 0.33
96 0.34
97 0.3
98 0.3
99 0.3
100 0.29
101 0.29
102 0.25
103 0.24
104 0.24
105 0.26
106 0.26
107 0.25
108 0.25
109 0.23