Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F8Q624

Protein Details
Accession F8Q624   
Localization Confidence Medium
Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
33-64PRSDHRRSRSPTRSQSPRRRDIRQRSRTHSQTHydrophilic
NLS Segment(s)
PositionSequence
17-58RSPSVSPRRRAPSIHAPRSDHRRSRSPTRSQSPRRRDIRQRS
Subcellular Location(s) nucl 25, cyto_nucl 14.5
Family & Domain DBs
Amino Acid Sequences MDDRRRRDDRFGNWRDRSPSVSPRRRAPSIHAPRSDHRRSRSPTRSQSPRRRDIRQRSRTHSQTSKSASRTTSPRSRGQLYSHPTSVVSRSPAHIGHEGTRHHEHEGSGKPQRYSRSISRPRDAPPFLDQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.75
2 0.71
3 0.65
4 0.6
5 0.56
6 0.58
7 0.58
8 0.63
9 0.61
10 0.65
11 0.7
12 0.68
13 0.63
14 0.61
15 0.61
16 0.63
17 0.66
18 0.63
19 0.6
20 0.63
21 0.7
22 0.71
23 0.67
24 0.62
25 0.62
26 0.63
27 0.69
28 0.72
29 0.72
30 0.73
31 0.75
32 0.8
33 0.81
34 0.85
35 0.84
36 0.84
37 0.81
38 0.8
39 0.81
40 0.82
41 0.82
42 0.82
43 0.8
44 0.78
45 0.81
46 0.76
47 0.73
48 0.68
49 0.6
50 0.56
51 0.54
52 0.51
53 0.45
54 0.43
55 0.36
56 0.34
57 0.36
58 0.36
59 0.38
60 0.37
61 0.41
62 0.43
63 0.45
64 0.44
65 0.44
66 0.46
67 0.44
68 0.44
69 0.39
70 0.34
71 0.31
72 0.3
73 0.27
74 0.21
75 0.19
76 0.16
77 0.16
78 0.19
79 0.19
80 0.21
81 0.23
82 0.22
83 0.23
84 0.27
85 0.27
86 0.3
87 0.34
88 0.32
89 0.31
90 0.3
91 0.28
92 0.3
93 0.35
94 0.36
95 0.39
96 0.42
97 0.42
98 0.45
99 0.5
100 0.47
101 0.48
102 0.5
103 0.53
104 0.59
105 0.65
106 0.68
107 0.68
108 0.69
109 0.71
110 0.65