Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F8PXW7

Protein Details
Accession F8PXW7    Localization Confidence Low Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
3-32APVFKRQPGRSSKSRRRTFKPNPTSPRLCTHydrophilic
NLS Segment(s)
PositionSequence
11-19GRSSKSRRR
Subcellular Location(s) mito 12, plas 7, nucl 3, E.R. 3
Family & Domain DBs
Amino Acid Sequences MYAPVFKRQPGRSSKSRRRTFKPNPTSPRLCTMFRVSCFVCRTTSFLPRRPVKPTQPRVPCSVFCVSYHVVSALISVSSPAPISIALAPEAPPVKRVSRSC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.77
2 0.8
3 0.84
4 0.85
5 0.83
6 0.86
7 0.86
8 0.86
9 0.86
10 0.86
11 0.84
12 0.84
13 0.83
14 0.74
15 0.71
16 0.64
17 0.54
18 0.47
19 0.46
20 0.43
21 0.39
22 0.4
23 0.33
24 0.35
25 0.35
26 0.33
27 0.27
28 0.22
29 0.26
30 0.24
31 0.33
32 0.32
33 0.36
34 0.43
35 0.47
36 0.49
37 0.5
38 0.53
39 0.53
40 0.6
41 0.62
42 0.63
43 0.66
44 0.65
45 0.65
46 0.63
47 0.54
48 0.48
49 0.43
50 0.35
51 0.27
52 0.29
53 0.25
54 0.21
55 0.21
56 0.17
57 0.13
58 0.12
59 0.11
60 0.07
61 0.06
62 0.05
63 0.05
64 0.05
65 0.05
66 0.06
67 0.05
68 0.05
69 0.05
70 0.07
71 0.08
72 0.09
73 0.09
74 0.1
75 0.1
76 0.14
77 0.17
78 0.16
79 0.17
80 0.19
81 0.24