Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q0UJ54

Protein Details
Accession Q0UJ54    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
28-47ARGGKKPKPKGEKPDEPKTDBasic
NLS Segment(s)
PositionSequence
29-41RGGKKPKPKGEKP
Subcellular Location(s) extr 21, E.R. 2, golg 2
Family & Domain DBs
KEGG pno:SNOG_08210  -  
Amino Acid Sequences MKLAFMVVLMVVLTLMIVAPVSADAIMARGGKKPKPKGEKPDEPKTDCKAGSKKCGSGDNAEEFWLYNCNSAGSWEQGTDCTNGCVGGPNDPHCW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.02
2 0.02
3 0.02
4 0.02
5 0.02
6 0.02
7 0.02
8 0.03
9 0.03
10 0.03
11 0.03
12 0.04
13 0.05
14 0.07
15 0.07
16 0.11
17 0.16
18 0.2
19 0.29
20 0.36
21 0.44
22 0.53
23 0.6
24 0.66
25 0.72
26 0.79
27 0.78
28 0.8
29 0.78
30 0.72
31 0.69
32 0.62
33 0.56
34 0.46
35 0.44
36 0.41
37 0.38
38 0.43
39 0.41
40 0.4
41 0.39
42 0.43
43 0.39
44 0.36
45 0.36
46 0.31
47 0.28
48 0.26
49 0.23
50 0.19
51 0.18
52 0.16
53 0.13
54 0.1
55 0.1
56 0.1
57 0.1
58 0.12
59 0.13
60 0.13
61 0.14
62 0.13
63 0.13
64 0.14
65 0.16
66 0.15
67 0.14
68 0.12
69 0.12
70 0.11
71 0.11
72 0.16
73 0.15
74 0.21
75 0.25