Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F8Q5T4

Protein Details
Accession F8Q5T4    Localization Confidence High Confidence Score 15.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MGRLRRSRAHHARRDVHRASRBasic
74-94ALRSHWRSKVHKRRCKELKEPBasic
NLS Segment(s)
Subcellular Location(s) nucl 22, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR003604  Matrin/U1-like-C_Znf_C2H2  
IPR022755  Znf_C2H2_jaz  
IPR036236  Znf_C2H2_sf  
IPR013087  Znf_C2H2_type  
Gene Ontology GO:0003676  F:nucleic acid binding  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF12171  zf-C2H2_jaz  
PROSITE View protein in PROSITE  
PS00028  ZINC_FINGER_C2H2_1  
Amino Acid Sequences MGRLRRSRAHHARRDVHRASRTRVRTKDLDQIQLIDLDPKNRAALEAQPLDFEKPGLAQHYCVECAKYYETDFALRSHWRSKVHKRRCKELKEPAYTIEEAERAAGLGREGKRPAAATEPPIPISVGMPL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.81
3 0.79
4 0.76
5 0.72
6 0.7
7 0.7
8 0.7
9 0.71
10 0.69
11 0.66
12 0.64
13 0.63
14 0.65
15 0.6
16 0.57
17 0.48
18 0.45
19 0.39
20 0.33
21 0.29
22 0.24
23 0.2
24 0.16
25 0.16
26 0.15
27 0.15
28 0.14
29 0.14
30 0.11
31 0.13
32 0.18
33 0.2
34 0.19
35 0.19
36 0.2
37 0.21
38 0.19
39 0.16
40 0.09
41 0.07
42 0.08
43 0.1
44 0.09
45 0.09
46 0.12
47 0.13
48 0.14
49 0.14
50 0.14
51 0.11
52 0.13
53 0.13
54 0.11
55 0.11
56 0.11
57 0.12
58 0.13
59 0.13
60 0.12
61 0.14
62 0.14
63 0.17
64 0.19
65 0.23
66 0.27
67 0.34
68 0.45
69 0.54
70 0.63
71 0.69
72 0.7
73 0.77
74 0.8
75 0.81
76 0.79
77 0.79
78 0.78
79 0.76
80 0.73
81 0.65
82 0.59
83 0.51
84 0.42
85 0.33
86 0.23
87 0.16
88 0.15
89 0.12
90 0.08
91 0.08
92 0.07
93 0.06
94 0.13
95 0.15
96 0.19
97 0.21
98 0.22
99 0.24
100 0.25
101 0.26
102 0.26
103 0.27
104 0.28
105 0.34
106 0.35
107 0.34
108 0.34
109 0.32
110 0.26