Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

F8PL45

Protein Details
Accession F8PL45    Localization Confidence High Confidence Score 18.9
NoLS Segment(s)
PositionSequenceProtein Nature
24-49RLAQRETATRPRKKPKKAKRADATGAHydrophilic
61-80RKQHPTSKAVRPKNVRNTCKHydrophilic
NLS Segment(s)
PositionSequence
32-44TRPRKKPKKAKRA
Subcellular Location(s) nucl 24, cyto 3
Family & Domain DBs
Amino Acid Sequences MDEVERNLLYRVGYERRCERLGERLAQRETATRPRKKPKKAKRADATGAALVVRQKKDCDRKQHPTSKAVRPKNVRNTCKPSPSRFLTRSRGDGVSFSSC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.33
2 0.38
3 0.42
4 0.44
5 0.44
6 0.41
7 0.42
8 0.44
9 0.46
10 0.45
11 0.47
12 0.47
13 0.46
14 0.45
15 0.39
16 0.38
17 0.41
18 0.44
19 0.45
20 0.53
21 0.62
22 0.71
23 0.78
24 0.84
25 0.85
26 0.86
27 0.88
28 0.9
29 0.87
30 0.86
31 0.79
32 0.72
33 0.62
34 0.51
35 0.41
36 0.31
37 0.23
38 0.16
39 0.17
40 0.13
41 0.12
42 0.14
43 0.21
44 0.32
45 0.38
46 0.46
47 0.52
48 0.61
49 0.7
50 0.77
51 0.74
52 0.73
53 0.74
54 0.73
55 0.74
56 0.72
57 0.71
58 0.69
59 0.75
60 0.77
61 0.8
62 0.78
63 0.77
64 0.79
65 0.77
66 0.79
67 0.76
68 0.72
69 0.7
70 0.69
71 0.69
72 0.66
73 0.67
74 0.65
75 0.65
76 0.63
77 0.59
78 0.55
79 0.47
80 0.43