Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

F8PK72

Protein Details
Accession F8PK72    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
34-57ASGATPKQHPRKRRKVDHAIEPGGBasic
NLS Segment(s)
PositionSequence
43-48PRKRRK
Subcellular Location(s) cyto 14.5, cyto_nucl 12.5, nucl 7.5, extr 2, pero 2
Family & Domain DBs
Amino Acid Sequences MTPATDVENPVDDTTFAALSRHVRRRIDDAFDEASGATPKQHPRKRRKVDHAIEPGGFVIEDAGGFIPEDIEPGGFL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.12
3 0.1
4 0.08
5 0.1
6 0.16
7 0.24
8 0.31
9 0.36
10 0.37
11 0.4
12 0.46
13 0.48
14 0.47
15 0.4
16 0.36
17 0.32
18 0.3
19 0.27
20 0.21
21 0.17
22 0.13
23 0.11
24 0.08
25 0.09
26 0.16
27 0.26
28 0.32
29 0.4
30 0.51
31 0.62
32 0.72
33 0.79
34 0.82
35 0.83
36 0.85
37 0.85
38 0.83
39 0.75
40 0.65
41 0.55
42 0.44
43 0.34
44 0.27
45 0.16
46 0.08
47 0.05
48 0.04
49 0.04
50 0.05
51 0.04
52 0.05
53 0.05
54 0.05
55 0.05
56 0.06
57 0.06