Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F8PZB9

Protein Details
Accession F8PZB9    Localization Confidence Medium Confidence Score 14.8
NoLS Segment(s)
PositionSequenceProtein Nature
90-114VGRGCKARRSHPRRTRAPKGFNSILHydrophilic
NLS Segment(s)
PositionSequence
45-54RKPRPKPGRP
96-106ARRSHPRRTRA
Subcellular Location(s) nucl 13, mito 10, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR012317  Poly(ADP-ribose)pol_cat_dom  
Gene Ontology GO:0003950  F:NAD+ ADP-ribosyltransferase activity  
Pfam View protein in Pfam  
PF00644  PARP  
Amino Acid Sequences GNERRRWHGTYCRNCKFLKNNLAKDGHCEPSQKCVICSIINTGFRKPRPKPGRPEKFGFGMYFSSTSSKQNGMAKPAKGVRALLLCKVAVGRGCKARRSHPRRTRAPKGFNSILGVPGVTPNLNYDELVTYDIAQNTPAYVIIYS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.7
2 0.71
3 0.68
4 0.68
5 0.67
6 0.67
7 0.65
8 0.68
9 0.72
10 0.63
11 0.61
12 0.56
13 0.5
14 0.42
15 0.4
16 0.33
17 0.36
18 0.42
19 0.36
20 0.32
21 0.3
22 0.3
23 0.27
24 0.27
25 0.25
26 0.25
27 0.3
28 0.32
29 0.33
30 0.37
31 0.4
32 0.48
33 0.46
34 0.5
35 0.54
36 0.61
37 0.67
38 0.72
39 0.79
40 0.75
41 0.77
42 0.69
43 0.63
44 0.56
45 0.46
46 0.36
47 0.26
48 0.21
49 0.17
50 0.14
51 0.13
52 0.12
53 0.13
54 0.13
55 0.13
56 0.16
57 0.21
58 0.21
59 0.25
60 0.29
61 0.28
62 0.3
63 0.31
64 0.3
65 0.24
66 0.24
67 0.19
68 0.2
69 0.2
70 0.18
71 0.17
72 0.15
73 0.14
74 0.14
75 0.13
76 0.11
77 0.13
78 0.15
79 0.22
80 0.24
81 0.29
82 0.32
83 0.41
84 0.49
85 0.55
86 0.64
87 0.65
88 0.73
89 0.78
90 0.85
91 0.86
92 0.85
93 0.86
94 0.82
95 0.81
96 0.74
97 0.64
98 0.59
99 0.48
100 0.39
101 0.3
102 0.23
103 0.15
104 0.13
105 0.13
106 0.09
107 0.08
108 0.09
109 0.12
110 0.13
111 0.13
112 0.13
113 0.14
114 0.14
115 0.16
116 0.14
117 0.12
118 0.15
119 0.16
120 0.14
121 0.14
122 0.13
123 0.12
124 0.12
125 0.11