Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F8PVS2

Protein Details
Accession F8PVS2    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
162-185LVEPKARPQKAKKDSPKQSQIKASHydrophilic
NLS Segment(s)
PositionSequence
150-176RRKARAERFGIPLVEPKARPQKAKKDS
230-237RRKKRAER
Subcellular Location(s) nucl 21.5, cyto_nucl 12.833, mito_nucl 12.666, mito 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR040746  THO1_MOS11_C  
Pfam View protein in Pfam  
PF18592  Tho1_MOS11_C  
Amino Acid Sequences MESKLKQLKVVDLRDILSKAAVSIPAKANKQDLINKIVATPAAVQVYQKQHPSATPKKTPSSAKAPSVSTSNDDLLAPPEDLDFDDPGLPQEAPVVKPSPTKQPPAYKLSRSDVPMPDAPAESPAEPPSSETPTDAQPAQDTVVDEELARRKARAERFGIPLVEPKARPQKAKKDSPKQSQIKASAVNDDPEKLQNRAARFGIPQKASNGSTGQKRAAPVEEVDAEELERRKKRAERFGTGAKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.42
3 0.33
4 0.25
5 0.2
6 0.15
7 0.15
8 0.18
9 0.15
10 0.19
11 0.25
12 0.3
13 0.33
14 0.34
15 0.35
16 0.34
17 0.39
18 0.42
19 0.39
20 0.39
21 0.38
22 0.36
23 0.34
24 0.32
25 0.26
26 0.2
27 0.17
28 0.14
29 0.13
30 0.13
31 0.13
32 0.18
33 0.25
34 0.27
35 0.28
36 0.26
37 0.26
38 0.3
39 0.39
40 0.42
41 0.44
42 0.49
43 0.52
44 0.55
45 0.6
46 0.62
47 0.58
48 0.59
49 0.56
50 0.53
51 0.51
52 0.48
53 0.44
54 0.41
55 0.36
56 0.3
57 0.27
58 0.22
59 0.19
60 0.17
61 0.16
62 0.15
63 0.15
64 0.12
65 0.09
66 0.09
67 0.08
68 0.09
69 0.1
70 0.08
71 0.07
72 0.08
73 0.08
74 0.08
75 0.09
76 0.09
77 0.07
78 0.1
79 0.1
80 0.11
81 0.13
82 0.14
83 0.13
84 0.17
85 0.19
86 0.26
87 0.28
88 0.33
89 0.37
90 0.44
91 0.48
92 0.52
93 0.55
94 0.48
95 0.49
96 0.47
97 0.45
98 0.39
99 0.39
100 0.33
101 0.32
102 0.3
103 0.27
104 0.23
105 0.2
106 0.17
107 0.14
108 0.13
109 0.1
110 0.1
111 0.09
112 0.09
113 0.09
114 0.11
115 0.12
116 0.13
117 0.13
118 0.13
119 0.14
120 0.14
121 0.16
122 0.15
123 0.13
124 0.1
125 0.11
126 0.11
127 0.1
128 0.09
129 0.08
130 0.09
131 0.09
132 0.08
133 0.1
134 0.13
135 0.15
136 0.15
137 0.14
138 0.16
139 0.23
140 0.3
141 0.34
142 0.35
143 0.37
144 0.42
145 0.45
146 0.42
147 0.36
148 0.35
149 0.31
150 0.29
151 0.25
152 0.26
153 0.34
154 0.36
155 0.42
156 0.46
157 0.54
158 0.59
159 0.7
160 0.74
161 0.75
162 0.82
163 0.85
164 0.88
165 0.83
166 0.8
167 0.77
168 0.71
169 0.64
170 0.59
171 0.5
172 0.46
173 0.41
174 0.37
175 0.3
176 0.27
177 0.25
178 0.25
179 0.27
180 0.22
181 0.26
182 0.27
183 0.29
184 0.33
185 0.32
186 0.29
187 0.3
188 0.37
189 0.4
190 0.39
191 0.39
192 0.36
193 0.4
194 0.39
195 0.37
196 0.33
197 0.3
198 0.34
199 0.36
200 0.36
201 0.33
202 0.34
203 0.35
204 0.34
205 0.31
206 0.26
207 0.27
208 0.26
209 0.24
210 0.24
211 0.21
212 0.18
213 0.2
214 0.23
215 0.26
216 0.29
217 0.3
218 0.37
219 0.44
220 0.54
221 0.6
222 0.66
223 0.67
224 0.7