Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F8PLJ9

Protein Details
Accession F8PLJ9    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
123-144LSHNWRGDRKGRHCHRERKGWFBasic
NLS Segment(s)
PositionSequence
112-115RRKR
Subcellular Location(s) nucl 11.5, cyto_nucl 9.333, mito 8, cyto 6, cyto_pero 3.833
Family & Domain DBs
Amino Acid Sequences MRSGGWKRAAYIGMDETQEMGSRGRGGNRVRPMRVFHEDARLASGERKGRGNGGTSGKVRNAQDRRSTNVAKMSMPEISGRGARIKDGTCTRGQYRGIQGLNDSIGKVTKVRRKRGRGDDCQLSHNWRGDRKGRHCHRERKGWFLEPRSLTGHPTAGLKTVQEVMSSLTRIGGASWVRAGKPRGVVFVNAGLG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.23
3 0.19
4 0.18
5 0.17
6 0.15
7 0.12
8 0.11
9 0.13
10 0.15
11 0.17
12 0.24
13 0.27
14 0.35
15 0.44
16 0.5
17 0.5
18 0.52
19 0.53
20 0.54
21 0.55
22 0.52
23 0.45
24 0.46
25 0.45
26 0.41
27 0.39
28 0.33
29 0.27
30 0.25
31 0.28
32 0.24
33 0.24
34 0.26
35 0.25
36 0.27
37 0.28
38 0.28
39 0.28
40 0.29
41 0.32
42 0.31
43 0.33
44 0.32
45 0.35
46 0.33
47 0.36
48 0.37
49 0.37
50 0.45
51 0.45
52 0.49
53 0.51
54 0.51
55 0.45
56 0.45
57 0.41
58 0.32
59 0.3
60 0.25
61 0.19
62 0.18
63 0.16
64 0.11
65 0.11
66 0.11
67 0.11
68 0.12
69 0.11
70 0.12
71 0.14
72 0.13
73 0.17
74 0.19
75 0.21
76 0.2
77 0.23
78 0.23
79 0.26
80 0.26
81 0.25
82 0.25
83 0.28
84 0.26
85 0.23
86 0.22
87 0.18
88 0.18
89 0.15
90 0.12
91 0.07
92 0.07
93 0.07
94 0.09
95 0.14
96 0.21
97 0.28
98 0.39
99 0.48
100 0.55
101 0.65
102 0.74
103 0.77
104 0.79
105 0.78
106 0.76
107 0.69
108 0.64
109 0.56
110 0.5
111 0.43
112 0.39
113 0.36
114 0.3
115 0.34
116 0.38
117 0.47
118 0.5
119 0.57
120 0.62
121 0.69
122 0.75
123 0.8
124 0.81
125 0.82
126 0.77
127 0.76
128 0.73
129 0.71
130 0.68
131 0.62
132 0.62
133 0.53
134 0.53
135 0.48
136 0.43
137 0.36
138 0.32
139 0.28
140 0.21
141 0.21
142 0.19
143 0.17
144 0.16
145 0.14
146 0.14
147 0.16
148 0.16
149 0.14
150 0.14
151 0.15
152 0.17
153 0.17
154 0.15
155 0.12
156 0.12
157 0.12
158 0.12
159 0.14
160 0.12
161 0.13
162 0.17
163 0.18
164 0.19
165 0.25
166 0.28
167 0.27
168 0.34
169 0.34
170 0.36
171 0.36
172 0.36
173 0.34