Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F8PZA4

Protein Details
Accession F8PZA4    Localization Confidence Medium Confidence Score 14.3
NoLS Segment(s)
PositionSequenceProtein Nature
364-402HMSRGEYRSDRRARRSERREARRHRKAGRRAAKARGDDQBasic
NLS Segment(s)
PositionSequence
372-398SDRRARRSERREARRHRKAGRRAAKAR
Subcellular Location(s) nucl 23.5, cyto_nucl 14
Family & Domain DBs
InterPro View protein in InterPro  
IPR028018  DUF4646  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF15496  DUF4646  
Amino Acid Sequences MHPEKSQNPYQQYQQPDWQNAQQPPPYQLEDSQAYPPPTGPPPVGGQYGYPQQPQGYASRDGPDVRSHPPPPQGYGQPQQGYQPPPGPPQGYGAPPPQGYSGYSQNAYGPGQPGQYPQPPSPYGQQSPGSYPAYQGGQQSPSDSQGGLHPYYSMSAGSSQPRAPSPGGDKGFSLSSFFGDKGPPPSWQRPPPQHLPYNPFPPMCLVSNSKNISNGFPELPPPCNLQPHPFASHDISEEDWKRFLTDVKKAGSLTGMQRIKSNVIPTVMGLNLIGGIFMTNAIERKMKTKNRTAAGDIVDHWNHYFFGPRRMEAVLCQASERLSGREGSAPHGSAEQERMARKLRRRTGSDDSSSSDSDSDDGRHMSRGEYRSDRRARRSERREARRHRKAGRRAAKARGDDQEPYMLYITPV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.61
3 0.6
4 0.6
5 0.59
6 0.6
7 0.58
8 0.6
9 0.57
10 0.52
11 0.51
12 0.51
13 0.47
14 0.42
15 0.39
16 0.37
17 0.35
18 0.35
19 0.35
20 0.35
21 0.33
22 0.32
23 0.3
24 0.29
25 0.29
26 0.3
27 0.25
28 0.23
29 0.25
30 0.28
31 0.29
32 0.25
33 0.23
34 0.25
35 0.31
36 0.31
37 0.28
38 0.26
39 0.25
40 0.26
41 0.27
42 0.27
43 0.24
44 0.25
45 0.26
46 0.27
47 0.29
48 0.29
49 0.29
50 0.3
51 0.29
52 0.29
53 0.35
54 0.34
55 0.37
56 0.44
57 0.44
58 0.43
59 0.45
60 0.47
61 0.47
62 0.52
63 0.54
64 0.48
65 0.46
66 0.46
67 0.45
68 0.42
69 0.39
70 0.37
71 0.32
72 0.34
73 0.38
74 0.36
75 0.31
76 0.32
77 0.32
78 0.29
79 0.3
80 0.29
81 0.29
82 0.27
83 0.27
84 0.24
85 0.22
86 0.2
87 0.2
88 0.23
89 0.22
90 0.22
91 0.21
92 0.21
93 0.22
94 0.22
95 0.2
96 0.16
97 0.15
98 0.15
99 0.16
100 0.17
101 0.2
102 0.25
103 0.27
104 0.27
105 0.31
106 0.31
107 0.33
108 0.37
109 0.39
110 0.35
111 0.36
112 0.38
113 0.34
114 0.36
115 0.38
116 0.34
117 0.27
118 0.26
119 0.23
120 0.21
121 0.21
122 0.2
123 0.18
124 0.18
125 0.18
126 0.19
127 0.18
128 0.18
129 0.17
130 0.15
131 0.13
132 0.13
133 0.17
134 0.15
135 0.14
136 0.13
137 0.12
138 0.13
139 0.13
140 0.09
141 0.06
142 0.08
143 0.1
144 0.12
145 0.14
146 0.15
147 0.16
148 0.17
149 0.19
150 0.18
151 0.18
152 0.2
153 0.26
154 0.27
155 0.26
156 0.25
157 0.23
158 0.24
159 0.21
160 0.18
161 0.1
162 0.1
163 0.1
164 0.11
165 0.1
166 0.1
167 0.11
168 0.14
169 0.16
170 0.19
171 0.23
172 0.29
173 0.35
174 0.42
175 0.48
176 0.51
177 0.56
178 0.61
179 0.62
180 0.61
181 0.58
182 0.58
183 0.55
184 0.53
185 0.49
186 0.4
187 0.34
188 0.3
189 0.28
190 0.22
191 0.2
192 0.18
193 0.18
194 0.25
195 0.26
196 0.25
197 0.26
198 0.25
199 0.24
200 0.22
201 0.21
202 0.15
203 0.14
204 0.17
205 0.16
206 0.17
207 0.17
208 0.19
209 0.19
210 0.22
211 0.23
212 0.24
213 0.26
214 0.28
215 0.3
216 0.27
217 0.28
218 0.25
219 0.25
220 0.22
221 0.19
222 0.16
223 0.18
224 0.19
225 0.18
226 0.17
227 0.16
228 0.15
229 0.15
230 0.19
231 0.19
232 0.23
233 0.27
234 0.28
235 0.3
236 0.3
237 0.29
238 0.26
239 0.23
240 0.19
241 0.23
242 0.23
243 0.22
244 0.23
245 0.25
246 0.26
247 0.25
248 0.25
249 0.18
250 0.17
251 0.17
252 0.16
253 0.16
254 0.14
255 0.12
256 0.1
257 0.07
258 0.06
259 0.06
260 0.05
261 0.03
262 0.03
263 0.03
264 0.03
265 0.04
266 0.04
267 0.05
268 0.07
269 0.09
270 0.1
271 0.15
272 0.24
273 0.32
274 0.38
275 0.47
276 0.53
277 0.57
278 0.6
279 0.58
280 0.54
281 0.49
282 0.44
283 0.36
284 0.33
285 0.28
286 0.25
287 0.22
288 0.17
289 0.15
290 0.14
291 0.2
292 0.17
293 0.26
294 0.28
295 0.28
296 0.3
297 0.3
298 0.31
299 0.24
300 0.31
301 0.25
302 0.23
303 0.22
304 0.21
305 0.2
306 0.22
307 0.22
308 0.15
309 0.13
310 0.14
311 0.15
312 0.19
313 0.19
314 0.21
315 0.22
316 0.21
317 0.21
318 0.21
319 0.21
320 0.19
321 0.21
322 0.2
323 0.21
324 0.22
325 0.25
326 0.32
327 0.39
328 0.45
329 0.53
330 0.58
331 0.63
332 0.67
333 0.71
334 0.73
335 0.74
336 0.71
337 0.64
338 0.58
339 0.53
340 0.48
341 0.41
342 0.32
343 0.24
344 0.19
345 0.17
346 0.15
347 0.14
348 0.15
349 0.16
350 0.18
351 0.18
352 0.2
353 0.26
354 0.27
355 0.32
356 0.39
357 0.44
358 0.52
359 0.61
360 0.67
361 0.68
362 0.76
363 0.79
364 0.81
365 0.84
366 0.85
367 0.86
368 0.89
369 0.9
370 0.91
371 0.92
372 0.92
373 0.93
374 0.92
375 0.91
376 0.91
377 0.91
378 0.9
379 0.9
380 0.86
381 0.86
382 0.85
383 0.8
384 0.76
385 0.72
386 0.66
387 0.58
388 0.54
389 0.51
390 0.42
391 0.39
392 0.33