Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F8PVQ6

Protein Details
Accession F8PVQ6    Localization Confidence Medium Confidence Score 14
NoLS Segment(s)
PositionSequenceProtein Nature
10-38SAEKGLEARQKKKRKERGNVGKNRNQSRDBasic
NLS Segment(s)
PositionSequence
17-32ARQKKKRKERGNVGKN
Subcellular Location(s) nucl 22.5, cyto_nucl 12, mito 3
Family & Domain DBs
Amino Acid Sequences MRETASGGESAEKGLEARQKKKRKERGNVGKNRNQSRDEGGEERLSYKARDIDVRKQRPNQEDEINKMTSYAKVNVRVNAIFCYERNRGGNRCIWDI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.19
3 0.23
4 0.33
5 0.42
6 0.52
7 0.62
8 0.72
9 0.79
10 0.83
11 0.87
12 0.89
13 0.9
14 0.92
15 0.92
16 0.9
17 0.86
18 0.84
19 0.81
20 0.74
21 0.64
22 0.56
23 0.5
24 0.45
25 0.42
26 0.35
27 0.3
28 0.27
29 0.25
30 0.24
31 0.2
32 0.17
33 0.13
34 0.13
35 0.13
36 0.13
37 0.19
38 0.21
39 0.3
40 0.4
41 0.47
42 0.52
43 0.55
44 0.61
45 0.61
46 0.61
47 0.56
48 0.54
49 0.5
50 0.49
51 0.48
52 0.41
53 0.36
54 0.32
55 0.28
56 0.23
57 0.23
58 0.23
59 0.23
60 0.3
61 0.33
62 0.34
63 0.37
64 0.36
65 0.34
66 0.3
67 0.3
68 0.24
69 0.22
70 0.26
71 0.25
72 0.29
73 0.33
74 0.37
75 0.37
76 0.41
77 0.47