Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

F8PPF8

Protein Details
Accession F8PPF8    Localization Confidence Medium Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
45-66SMQYGCREKYRRRSCCHRYVAKHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 25.5, cyto_nucl 14
Family & Domain DBs
Amino Acid Sequences MSFDVGGSRIDERLQRINVLPDEKRARKVGCNRSSRSKAIRDLDSMQYGCREKYRRRSCCHRYVAK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.26
3 0.27
4 0.31
5 0.32
6 0.35
7 0.31
8 0.32
9 0.39
10 0.39
11 0.41
12 0.41
13 0.39
14 0.42
15 0.51
16 0.54
17 0.54
18 0.59
19 0.59
20 0.64
21 0.66
22 0.63
23 0.58
24 0.53
25 0.51
26 0.49
27 0.48
28 0.42
29 0.41
30 0.4
31 0.39
32 0.34
33 0.27
34 0.27
35 0.26
36 0.24
37 0.27
38 0.31
39 0.36
40 0.47
41 0.57
42 0.62
43 0.69
44 0.79
45 0.81
46 0.85