Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F8PVT3

Protein Details
Accession F8PVT3    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-24MLHKIRNSERKKRQKAISKAWYSSHydrophilic
NLS Segment(s)
PositionSequence
10-14RKKRQ
Subcellular Location(s) mito 14, nucl 11, cyto_nucl 8.5
Family & Domain DBs
Amino Acid Sequences MLHKIRNSERKKRQKAISKAWYSSAYRLHCPASRLRPLRHPLPLSHPTRPSPPPLSISRQTQPPSRNQIKQKGAEVPR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.88
2 0.89
3 0.88
4 0.88
5 0.83
6 0.75
7 0.69
8 0.64
9 0.55
10 0.49
11 0.45
12 0.38
13 0.33
14 0.33
15 0.33
16 0.3
17 0.3
18 0.33
19 0.33
20 0.39
21 0.42
22 0.42
23 0.47
24 0.49
25 0.51
26 0.5
27 0.45
28 0.38
29 0.41
30 0.47
31 0.43
32 0.44
33 0.43
34 0.39
35 0.43
36 0.43
37 0.41
38 0.37
39 0.35
40 0.35
41 0.36
42 0.42
43 0.41
44 0.45
45 0.42
46 0.45
47 0.46
48 0.48
49 0.48
50 0.49
51 0.55
52 0.57
53 0.62
54 0.64
55 0.71
56 0.73
57 0.74
58 0.71