Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

F8PL14

Protein Details
Accession F8PL14    Localization Confidence Low Confidence Score 7.6
NoLS Segment(s)
PositionSequenceProtein Nature
37-56QLVVCRCNMRKRRSCDRGGTHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 9, cyto_nucl 7.833, cysk 6, cyto 4.5, mito 4, cyto_pero 3.166
Family & Domain DBs
Amino Acid Sequences MDSLDIVKQFVLATDTTWLARLDEGGLGGLQLLYDMQLVVCRCNMRKRRSCDRGGT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.11
3 0.1
4 0.12
5 0.11
6 0.1
7 0.1
8 0.09
9 0.08
10 0.07
11 0.07
12 0.05
13 0.05
14 0.04
15 0.04
16 0.04
17 0.03
18 0.02
19 0.02
20 0.02
21 0.03
22 0.03
23 0.03
24 0.06
25 0.07
26 0.08
27 0.1
28 0.13
29 0.17
30 0.27
31 0.36
32 0.44
33 0.53
34 0.61
35 0.7
36 0.76