Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

F8Q1Z7

Protein Details
Accession F8Q1Z7    Localization Confidence Medium Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
1-36RERKRRKVPILGRNPIRNKRKKERRRKTGPDIPIPVBasic
NLS Segment(s)
PositionSequence
3-28RKRRKVPILGRNPIRNKRKKERRRKT
Subcellular Location(s) nucl 22.5, cyto_nucl 12.333, mito 3.5
Family & Domain DBs
Amino Acid Sequences RERKRRKVPILGRNPIRNKRKKERRRKTGPDIPIPVVEKEWRWTRQSSARKDDATDAEKRDIEASNDERGKGKTP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.84
3 0.84
4 0.83
5 0.82
6 0.83
7 0.86
8 0.88
9 0.9
10 0.91
11 0.92
12 0.93
13 0.93
14 0.92
15 0.9
16 0.86
17 0.83
18 0.76
19 0.66
20 0.58
21 0.5
22 0.4
23 0.32
24 0.25
25 0.18
26 0.17
27 0.22
28 0.21
29 0.22
30 0.24
31 0.27
32 0.36
33 0.45
34 0.48
35 0.5
36 0.53
37 0.51
38 0.51
39 0.51
40 0.47
41 0.42
42 0.39
43 0.35
44 0.33
45 0.33
46 0.32
47 0.29
48 0.25
49 0.24
50 0.26
51 0.26
52 0.31
53 0.32
54 0.33
55 0.34