Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

F8QF81

Protein Details
Accession F8QF81    Localization Confidence Medium Confidence Score 14.7
NoLS Segment(s)
PositionSequenceProtein Nature
81-123PLDLRPKKTRAIRRQLTKREASLKTLKQRKKDIHFPIRKYAVKHydrophilic
NLS Segment(s)
PositionSequence
75-118KGKKHLPLDLRPKKTRAIRRQLTKREASLKTLKQRKKDIHFPIR
Subcellular Location(s) nucl 18, cyto 5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR001854  Ribosomal_L29/L35  
IPR036049  Ribosomal_L29/L35_sf  
IPR018254  Ribosomal_L29_CS  
IPR045059  RL35  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0000463  P:maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00831  Ribosomal_L29  
PROSITE View protein in PROSITE  
PS00579  RIBOSOMAL_L29  
CDD cd00427  Ribosomal_L29_HIP  
Amino Acid Sequences MPGKVKAYELQSKSKNDLSKQLVDLKHELLTLRVQKIAGGSASKLTKINVVRKSIARVMTVMNQKARQNLREFYKGKKHLPLDLRPKKTRAIRRQLTKREASLKTLKQRKKDIHFPIRKYAVKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.55
3 0.48
4 0.53
5 0.5
6 0.49
7 0.48
8 0.51
9 0.47
10 0.45
11 0.45
12 0.37
13 0.32
14 0.28
15 0.24
16 0.18
17 0.22
18 0.23
19 0.22
20 0.21
21 0.2
22 0.2
23 0.2
24 0.2
25 0.15
26 0.11
27 0.1
28 0.13
29 0.14
30 0.14
31 0.14
32 0.13
33 0.17
34 0.21
35 0.29
36 0.3
37 0.33
38 0.35
39 0.35
40 0.39
41 0.37
42 0.34
43 0.26
44 0.22
45 0.2
46 0.23
47 0.26
48 0.24
49 0.23
50 0.24
51 0.24
52 0.3
53 0.31
54 0.29
55 0.29
56 0.31
57 0.34
58 0.4
59 0.41
60 0.4
61 0.48
62 0.5
63 0.49
64 0.52
65 0.49
66 0.47
67 0.52
68 0.55
69 0.57
70 0.61
71 0.66
72 0.62
73 0.63
74 0.63
75 0.66
76 0.67
77 0.66
78 0.68
79 0.69
80 0.76
81 0.84
82 0.86
83 0.85
84 0.8
85 0.75
86 0.73
87 0.66
88 0.62
89 0.61
90 0.59
91 0.62
92 0.67
93 0.67
94 0.66
95 0.74
96 0.77
97 0.76
98 0.79
99 0.79
100 0.81
101 0.84
102 0.81
103 0.82
104 0.81