Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F8QHZ9

Protein Details
Accession F8QHZ9   
Localization Confidence Low
Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
54-80LLFRFRPQYCLQKRRRKGTRGALYCNLHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14.5, mito 9, cyto_nucl 9
Family & Domain DBs
Amino Acid Sequences MLSWTLQDSGFSYTQGLYLEHVAQIGGYWAQELRWTASGQHSVGNKAFLSFTRLLFRFRPQYCLQKRRRKGTRGALYCNLYVFCSI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.15
3 0.13
4 0.1
5 0.11
6 0.12
7 0.11
8 0.11
9 0.09
10 0.08
11 0.07
12 0.07
13 0.05
14 0.04
15 0.04
16 0.04
17 0.05
18 0.06
19 0.07
20 0.09
21 0.1
22 0.11
23 0.11
24 0.14
25 0.16
26 0.15
27 0.18
28 0.17
29 0.17
30 0.17
31 0.17
32 0.14
33 0.13
34 0.13
35 0.09
36 0.14
37 0.13
38 0.14
39 0.19
40 0.2
41 0.23
42 0.24
43 0.29
44 0.33
45 0.32
46 0.37
47 0.36
48 0.46
49 0.53
50 0.62
51 0.67
52 0.69
53 0.77
54 0.82
55 0.87
56 0.84
57 0.84
58 0.84
59 0.85
60 0.81
61 0.8
62 0.76
63 0.71
64 0.64
65 0.56
66 0.45