Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q0U170

Protein Details
Accession Q0U170    Localization Confidence Medium Confidence Score 14.6
NoLS Segment(s)
PositionSequenceProtein Nature
20-42QGSNGLPQRKKSRSRSREGSSGNHydrophilic
87-162SPEPYKKPRGSSRERRRDRSRDHTRDRSRDRRRDRDGGRDRSTERKRSRSRDRRRDRSRDKRRDRSKDRDSKRDRSBasic
NLS Segment(s)
PositionSequence
28-160RKKSRSRSREGSSGNAPPHKEPLPVPEHRSERPMKSSRPRDASRERGVKEAPSAAGRELSPEPYKKPRGSSRERRRDRSRDHTRDRSRDRRRDRDGGRDRSTERKRSRSRDRRRDRSRDKRRDRSKDRDSKRD
Subcellular Location(s) nucl 18, cyto_nucl 12, mito 5, cyto 4
Family & Domain DBs
Gene Ontology GO:0071011  C:precatalytic spliceosome  
KEGG pno:SNOG_14581  -  
Amino Acid Sequences MARELSPFSARRLLTQQLAQGSNGLPQRKKSRSRSREGSSGNAPPHKEPLPVPEHRSERPMKSSRPRDASRERGVKEAPSAAGRELSPEPYKKPRGSSRERRRDRSRDHTRDRSRDRRRDRDGGRDRSTERKRSRSRDRRRDRSRDKRRDRSKDRDSKRDRSQGPSTVGETARAQETGSAGTDPRKAVAPALPTAHASIEPAQPPQPPPPHHRNVVAEPHHALPLPTSAQRSPSPRKKYPSAASTTQNKRPPNTAVHPPTRRSPTSSPRVP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.39
3 0.39
4 0.38
5 0.39
6 0.35
7 0.32
8 0.27
9 0.28
10 0.3
11 0.32
12 0.28
13 0.35
14 0.44
15 0.51
16 0.61
17 0.66
18 0.73
19 0.76
20 0.83
21 0.86
22 0.82
23 0.82
24 0.76
25 0.71
26 0.66
27 0.63
28 0.59
29 0.54
30 0.49
31 0.42
32 0.43
33 0.39
34 0.36
35 0.3
36 0.32
37 0.35
38 0.38
39 0.41
40 0.44
41 0.47
42 0.47
43 0.52
44 0.5
45 0.48
46 0.52
47 0.53
48 0.54
49 0.6
50 0.67
51 0.69
52 0.72
53 0.71
54 0.7
55 0.73
56 0.73
57 0.72
58 0.7
59 0.63
60 0.59
61 0.56
62 0.49
63 0.42
64 0.36
65 0.28
66 0.21
67 0.21
68 0.16
69 0.17
70 0.15
71 0.16
72 0.15
73 0.18
74 0.2
75 0.21
76 0.25
77 0.32
78 0.39
79 0.37
80 0.44
81 0.48
82 0.53
83 0.62
84 0.69
85 0.72
86 0.77
87 0.82
88 0.84
89 0.85
90 0.85
91 0.83
92 0.83
93 0.83
94 0.82
95 0.84
96 0.85
97 0.84
98 0.85
99 0.85
100 0.85
101 0.84
102 0.84
103 0.85
104 0.84
105 0.83
106 0.82
107 0.77
108 0.77
109 0.76
110 0.75
111 0.69
112 0.63
113 0.58
114 0.59
115 0.61
116 0.6
117 0.56
118 0.57
119 0.61
120 0.66
121 0.75
122 0.76
123 0.81
124 0.83
125 0.87
126 0.88
127 0.91
128 0.93
129 0.92
130 0.93
131 0.93
132 0.93
133 0.93
134 0.92
135 0.93
136 0.93
137 0.91
138 0.9
139 0.89
140 0.88
141 0.85
142 0.85
143 0.82
144 0.8
145 0.8
146 0.79
147 0.7
148 0.67
149 0.66
150 0.61
151 0.57
152 0.5
153 0.43
154 0.37
155 0.35
156 0.29
157 0.24
158 0.19
159 0.16
160 0.14
161 0.12
162 0.09
163 0.09
164 0.09
165 0.09
166 0.08
167 0.08
168 0.1
169 0.13
170 0.12
171 0.13
172 0.13
173 0.13
174 0.14
175 0.17
176 0.17
177 0.17
178 0.19
179 0.19
180 0.18
181 0.18
182 0.17
183 0.14
184 0.13
185 0.13
186 0.15
187 0.15
188 0.17
189 0.18
190 0.2
191 0.23
192 0.29
193 0.34
194 0.35
195 0.42
196 0.5
197 0.54
198 0.56
199 0.59
200 0.57
201 0.55
202 0.6
203 0.56
204 0.49
205 0.45
206 0.43
207 0.38
208 0.33
209 0.26
210 0.18
211 0.17
212 0.18
213 0.18
214 0.2
215 0.2
216 0.25
217 0.3
218 0.37
219 0.44
220 0.51
221 0.58
222 0.62
223 0.69
224 0.72
225 0.76
226 0.77
227 0.74
228 0.72
229 0.68
230 0.68
231 0.7
232 0.71
233 0.7
234 0.69
235 0.65
236 0.61
237 0.61
238 0.59
239 0.58
240 0.56
241 0.58
242 0.6
243 0.66
244 0.69
245 0.68
246 0.72
247 0.71
248 0.67
249 0.64
250 0.64
251 0.64