Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

F8PGV8

Protein Details
Accession F8PGV8    Localization Confidence Medium Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
5-30LELYASTRYAKKRKYRPKKIEIVTGTHydrophilic
NLS Segment(s)
PositionSequence
15-23KKRKYRPKK
Subcellular Location(s) nucl 16, mito 7, cyto 4
Family & Domain DBs
Amino Acid Sequences MQRRLELYASTRYAKKRKYRPKKIEIVTGTDGVDRMPPKYRCGERLYGGMAGNEAQGVEEYNRGGSGDQIMIGAQREIKLKIHHSEESPRVFKVVEDNGRSLGTIR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.61
3 0.65
4 0.73
5 0.8
6 0.86
7 0.89
8 0.9
9 0.92
10 0.86
11 0.85
12 0.76
13 0.72
14 0.63
15 0.54
16 0.44
17 0.34
18 0.29
19 0.19
20 0.2
21 0.13
22 0.12
23 0.19
24 0.2
25 0.23
26 0.3
27 0.33
28 0.34
29 0.39
30 0.41
31 0.34
32 0.35
33 0.34
34 0.28
35 0.26
36 0.21
37 0.16
38 0.12
39 0.1
40 0.07
41 0.06
42 0.03
43 0.03
44 0.04
45 0.04
46 0.05
47 0.05
48 0.05
49 0.05
50 0.05
51 0.05
52 0.05
53 0.06
54 0.06
55 0.06
56 0.06
57 0.06
58 0.06
59 0.07
60 0.07
61 0.06
62 0.08
63 0.1
64 0.11
65 0.15
66 0.18
67 0.22
68 0.27
69 0.32
70 0.33
71 0.35
72 0.41
73 0.45
74 0.49
75 0.46
76 0.41
77 0.37
78 0.34
79 0.31
80 0.3
81 0.33
82 0.33
83 0.35
84 0.36
85 0.37
86 0.37