Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F8Q771

Protein Details
Accession F8Q771    Localization Confidence High Confidence Score 16.4
NoLS Segment(s)
PositionSequenceProtein Nature
38-57AAPVKRGRGRPKGSRNKKSGBasic
65-110SSEAGVKRKRGRPPKERKANESGEEEPVTKRKRGRPPKTSKTETAABasic
NLS Segment(s)
PositionSequence
41-103VKRGRGRPKGSRNKKSGGSTAPGASSEAGVKRKRGRPPKERKANESGEEEPVTKRKRGRPPKT
Subcellular Location(s) nucl 23.5, cyto_nucl 13
Family & Domain DBs
InterPro View protein in InterPro  
IPR017956  AT_hook_DNA-bd_motif  
Gene Ontology GO:0003677  F:DNA binding  
Pfam View protein in Pfam  
PF02178  AT_hook  
Amino Acid Sequences MSASPQQEAVADNKFDDLDEREQPTADETEGAGEVSDAAPVKRGRGRPKGSRNKKSGGSTAPGASSEAGVKRKRGRPPKERKANESGEEEPVTKRKRGRPPKTSKTETAAGAESGGEW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.16
3 0.17
4 0.18
5 0.18
6 0.22
7 0.25
8 0.24
9 0.24
10 0.25
11 0.24
12 0.21
13 0.17
14 0.13
15 0.09
16 0.1
17 0.1
18 0.1
19 0.07
20 0.06
21 0.06
22 0.05
23 0.06
24 0.05
25 0.05
26 0.1
27 0.1
28 0.13
29 0.18
30 0.24
31 0.31
32 0.41
33 0.48
34 0.53
35 0.64
36 0.73
37 0.79
38 0.82
39 0.79
40 0.74
41 0.72
42 0.65
43 0.58
44 0.5
45 0.42
46 0.34
47 0.3
48 0.25
49 0.2
50 0.17
51 0.12
52 0.1
53 0.09
54 0.1
55 0.15
56 0.16
57 0.2
58 0.28
59 0.34
60 0.43
61 0.52
62 0.59
63 0.65
64 0.75
65 0.82
66 0.85
67 0.84
68 0.82
69 0.8
70 0.76
71 0.69
72 0.63
73 0.54
74 0.47
75 0.43
76 0.37
77 0.31
78 0.33
79 0.32
80 0.31
81 0.36
82 0.41
83 0.51
84 0.61
85 0.7
86 0.73
87 0.81
88 0.87
89 0.91
90 0.89
91 0.83
92 0.78
93 0.72
94 0.63
95 0.56
96 0.46
97 0.36
98 0.29