Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

C4R6D3

Protein Details
Accession C4R6D3    Localization Confidence Medium Confidence Score 12.4
NoLS Segment(s)
PositionSequenceProtein Nature
4-33TSAPRPTIVKKYTKKFKRHHSDRYHRVGESHydrophilic
NLS Segment(s)
PositionSequence
17-21KKFKR
Subcellular Location(s) nucl 12, mito 11, cyto 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR001515  Ribosomal_L32e  
IPR018263  Ribosomal_L32e_CS  
IPR036351  Ribosomal_L32e_sf  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG ppa:PAS_chr3_1057  -  
Pfam View protein in Pfam  
PF01655  Ribosomal_L32e  
PROSITE View protein in PROSITE  
PS00580  RIBOSOMAL_L32E  
CDD cd00513  Ribosomal_L32_L32e  
Amino Acid Sequences MSETSAPRPTIVKKYTKKFKRHHSDRYHRVGESWRKQKGIDSCVRRRFRGTIRQPKIGYGSDKRTKYMLKSGHKAFVVNNAKELDVLLLHNQQYAAEIAHAVSSKNRVHILARAKELGIKVTNPQGRLNLEA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.72
3 0.77
4 0.82
5 0.81
6 0.86
7 0.87
8 0.88
9 0.88
10 0.89
11 0.91
12 0.9
13 0.9
14 0.83
15 0.72
16 0.64
17 0.63
18 0.62
19 0.61
20 0.6
21 0.55
22 0.52
23 0.52
24 0.55
25 0.53
26 0.5
27 0.49
28 0.49
29 0.55
30 0.63
31 0.67
32 0.62
33 0.58
34 0.56
35 0.55
36 0.57
37 0.58
38 0.6
39 0.61
40 0.67
41 0.64
42 0.6
43 0.56
44 0.48
45 0.42
46 0.35
47 0.38
48 0.38
49 0.38
50 0.38
51 0.36
52 0.35
53 0.32
54 0.35
55 0.35
56 0.33
57 0.39
58 0.4
59 0.43
60 0.41
61 0.4
62 0.33
63 0.34
64 0.36
65 0.3
66 0.3
67 0.26
68 0.26
69 0.25
70 0.25
71 0.15
72 0.08
73 0.09
74 0.08
75 0.1
76 0.1
77 0.11
78 0.11
79 0.1
80 0.11
81 0.11
82 0.09
83 0.06
84 0.06
85 0.06
86 0.08
87 0.08
88 0.07
89 0.09
90 0.14
91 0.15
92 0.18
93 0.19
94 0.19
95 0.21
96 0.27
97 0.35
98 0.35
99 0.38
100 0.37
101 0.36
102 0.37
103 0.36
104 0.34
105 0.28
106 0.23
107 0.23
108 0.31
109 0.34
110 0.33
111 0.35
112 0.35