Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F8QDR9

Protein Details
Accession F8QDR9    Localization Confidence Medium Confidence Score 11.9
NoLS Segment(s)
PositionSequenceProtein Nature
36-61KYKSSKLSDVKARKRKRKGDSTSILGHydrophilic
NLS Segment(s)
PositionSequence
42-53LSDVKARKRKRK
Subcellular Location(s) nucl 14.5, cyto_nucl 10, mito 8, cyto 4.5
Family & Domain DBs
Amino Acid Sequences MCQSQVTRPASPVKGVLDNSSASNVDNKGESVKNSKYKSSKLSDVKARKRKRKGDSTSILGGNVLLHITWI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.31
3 0.3
4 0.24
5 0.23
6 0.22
7 0.21
8 0.18
9 0.13
10 0.15
11 0.13
12 0.12
13 0.11
14 0.11
15 0.12
16 0.13
17 0.14
18 0.17
19 0.22
20 0.29
21 0.3
22 0.35
23 0.35
24 0.38
25 0.42
26 0.42
27 0.45
28 0.43
29 0.48
30 0.53
31 0.59
32 0.66
33 0.7
34 0.76
35 0.77
36 0.82
37 0.85
38 0.85
39 0.86
40 0.84
41 0.85
42 0.82
43 0.78
44 0.73
45 0.65
46 0.55
47 0.44
48 0.35
49 0.25
50 0.18
51 0.12