Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F8QDJ1

Protein Details
Accession F8QDJ1   
Localization Confidence Medium
Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-27GLYSHKVKSNSKKRAGSKIKNNRTVNEHydrophilic
NLS Segment(s)
PositionSequence
12-15KKRA
Subcellular Location(s) mito 13.5, mito_nucl 13.166, nucl 11.5, cyto_nucl 7.333
Family & Domain DBs
Amino Acid Sequences GLYSHKVKSNSKKRAGSKIKNNRTVNECSAEEKETGATGPPPSPNPTVPWPYQWTGCVGPPDQTREGEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.82
2 0.84
3 0.83
4 0.83
5 0.84
6 0.85
7 0.86
8 0.82
9 0.76
10 0.7
11 0.66
12 0.58
13 0.51
14 0.42
15 0.35
16 0.34
17 0.3
18 0.25
19 0.2
20 0.17
21 0.12
22 0.11
23 0.08
24 0.07
25 0.07
26 0.08
27 0.1
28 0.12
29 0.15
30 0.18
31 0.18
32 0.21
33 0.26
34 0.3
35 0.29
36 0.33
37 0.34
38 0.34
39 0.35
40 0.31
41 0.3
42 0.27
43 0.29
44 0.28
45 0.23
46 0.28
47 0.3
48 0.36
49 0.34