Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F8PPA0

Protein Details
Accession F8PPA0    Localization Confidence Medium Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
88-114AATTPAPNKNAKKRQQQKARRAANADKHydrophilic
NLS Segment(s)
PositionSequence
97-107NAKKRQQQKAR
Subcellular Location(s) cyto 9.5, cyto_nucl 9, nucl 7.5, pero 5, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR039333  PYM1  
IPR015362  WIBG_mago-bd  
IPR036348  WIBG_N_sf  
Gene Ontology GO:1903259  P:exon-exon junction complex disassembly  
Pfam View protein in Pfam  
PF09282  Mago-bind  
Amino Acid Sequences MSKPPINPDKTAAGIALDPRTLERVIPESKRPDGSVRKQIKIRPGFTPQEDVRRFRGTKQAQMDATSLPKGHIIGWIPPSSAQNKAGAATTPAPNKNAKKRQQQKARRAANADKVAVKEDWEDEDE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.22
3 0.2
4 0.15
5 0.13
6 0.13
7 0.16
8 0.15
9 0.13
10 0.13
11 0.17
12 0.22
13 0.26
14 0.31
15 0.34
16 0.37
17 0.39
18 0.38
19 0.41
20 0.44
21 0.49
22 0.53
23 0.54
24 0.56
25 0.59
26 0.61
27 0.63
28 0.61
29 0.56
30 0.5
31 0.5
32 0.49
33 0.46
34 0.5
35 0.41
36 0.44
37 0.44
38 0.42
39 0.39
40 0.41
41 0.4
42 0.35
43 0.43
44 0.36
45 0.4
46 0.41
47 0.41
48 0.35
49 0.37
50 0.35
51 0.26
52 0.25
53 0.19
54 0.14
55 0.1
56 0.1
57 0.09
58 0.08
59 0.1
60 0.1
61 0.12
62 0.15
63 0.15
64 0.15
65 0.16
66 0.17
67 0.17
68 0.18
69 0.16
70 0.15
71 0.15
72 0.16
73 0.15
74 0.14
75 0.15
76 0.15
77 0.18
78 0.22
79 0.23
80 0.25
81 0.31
82 0.38
83 0.46
84 0.53
85 0.58
86 0.64
87 0.73
88 0.81
89 0.86
90 0.89
91 0.89
92 0.9
93 0.9
94 0.85
95 0.82
96 0.79
97 0.78
98 0.73
99 0.66
100 0.58
101 0.5
102 0.47
103 0.4
104 0.34
105 0.26
106 0.22