Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F8PWZ7

Protein Details
Accession F8PWZ7   
Localization Confidence Medium
Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
42-66RAKKERDEKKSRRLASKKRRDNGVVBasic
NLS Segment(s)
PositionSequence
40-75ESRAKKERDEKKSRRLASKKRRDNGVVGKREAKEKG
Subcellular Location(s) nucl 16, cyto_nucl 13.333, mito_nucl 9.999, cyto 7.5
Family & Domain DBs
Amino Acid Sequences ATPFTPEFVQSSVTQASDPAGIYTNRIKGRQVLLENPVRESRAKKERDEKKSRRLASKKRRDNGVVGKREAKEKGLWKLEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.14
3 0.14
4 0.12
5 0.12
6 0.09
7 0.1
8 0.1
9 0.13
10 0.16
11 0.22
12 0.23
13 0.24
14 0.24
15 0.25
16 0.29
17 0.32
18 0.31
19 0.27
20 0.3
21 0.34
22 0.34
23 0.32
24 0.29
25 0.25
26 0.24
27 0.23
28 0.25
29 0.29
30 0.32
31 0.35
32 0.44
33 0.53
34 0.62
35 0.71
36 0.71
37 0.72
38 0.78
39 0.79
40 0.79
41 0.8
42 0.8
43 0.81
44 0.84
45 0.84
46 0.81
47 0.83
48 0.76
49 0.74
50 0.74
51 0.73
52 0.69
53 0.63
54 0.63
55 0.58
56 0.6
57 0.53
58 0.46
59 0.43
60 0.43
61 0.49