Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

F8PVR7

Protein Details
Accession F8PVR7    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
74-116RGTEYQPSQRKRKRKHGFLARKRSITGRRILARRKARGRTFLSHydrophilic
NLS Segment(s)
PositionSequence
83-112RKRKRKHGFLARKRSITGRRILARRKARGR
Subcellular Location(s) mito 19, nucl 5, cyto 1, plas 1, extr 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR000271  Ribosomal_L34  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00468  Ribosomal_L34  
Amino Acid Sequences MPRILRQLVRLLSRPPTLQALPSRAASHLRAFQATLPFCSQILNNHNPLLFGPAQHRISSPILAAVHQVRFAARGTEYQPSQRKRKRKHGFLARKRSITGRRILARRKARGRTFLSH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.41
2 0.35
3 0.35
4 0.31
5 0.33
6 0.35
7 0.33
8 0.32
9 0.33
10 0.32
11 0.28
12 0.3
13 0.27
14 0.26
15 0.26
16 0.25
17 0.24
18 0.23
19 0.25
20 0.28
21 0.27
22 0.25
23 0.21
24 0.21
25 0.2
26 0.2
27 0.18
28 0.17
29 0.23
30 0.24
31 0.24
32 0.25
33 0.25
34 0.24
35 0.24
36 0.22
37 0.15
38 0.12
39 0.13
40 0.18
41 0.19
42 0.19
43 0.19
44 0.18
45 0.19
46 0.19
47 0.16
48 0.13
49 0.12
50 0.12
51 0.13
52 0.12
53 0.11
54 0.11
55 0.11
56 0.08
57 0.09
58 0.1
59 0.09
60 0.08
61 0.1
62 0.12
63 0.17
64 0.18
65 0.24
66 0.32
67 0.37
68 0.47
69 0.53
70 0.61
71 0.66
72 0.77
73 0.8
74 0.82
75 0.87
76 0.87
77 0.91
78 0.91
79 0.93
80 0.9
81 0.82
82 0.73
83 0.71
84 0.68
85 0.62
86 0.59
87 0.56
88 0.57
89 0.63
90 0.69
91 0.71
92 0.73
93 0.77
94 0.79
95 0.8
96 0.79
97 0.8