Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

F8QFP3

Protein Details
Accession F8QFP3   
Localization Confidence Medium
Confidence Score 11.8
NoLS Segment(s)
PositionSequenceProtein Nature
32-57QRRGGWGRRDDRRHRRRGRHLCTVEGBasic
NLS Segment(s)
PositionSequence
33-50RRGGWGRRDDRRHRRRGR
Subcellular Location(s) nucl 11, mito 7, cyto 6.5, cyto_pero 4.5
Family & Domain DBs
Amino Acid Sequences MPRVNRSVYNTISTDTKNFHEFEGFIVNEGAQRRGGWGRRDDRRHRRRGRHLCTVEGASRASQVPNDEKLAPMNRK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.29
2 0.25
3 0.25
4 0.24
5 0.23
6 0.22
7 0.21
8 0.19
9 0.18
10 0.21
11 0.18
12 0.15
13 0.15
14 0.14
15 0.15
16 0.15
17 0.14
18 0.09
19 0.09
20 0.11
21 0.15
22 0.19
23 0.21
24 0.27
25 0.33
26 0.41
27 0.5
28 0.58
29 0.65
30 0.71
31 0.78
32 0.81
33 0.84
34 0.87
35 0.9
36 0.87
37 0.87
38 0.8
39 0.72
40 0.66
41 0.59
42 0.5
43 0.4
44 0.34
45 0.23
46 0.22
47 0.19
48 0.17
49 0.15
50 0.17
51 0.2
52 0.23
53 0.26
54 0.25
55 0.25
56 0.3